KEGG   Methylomonas methanica: Metme_3652Help
Entry
Metme_3652        CDS       T01511                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmt  Methylomonas methanica
Pathway
mmt00250  Alanine, aspartate and glutamate metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metme_3652
Enzymes [BR:mmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Metme_3652
Peptidases [BR:mmt01002]
 Cysteine Peptidases
  Family C44
   Metme_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEG02013
JGI: Metme_3652
UniProt: F9ZW42
Position
4058622..4060505
Genome map
AA seq 627 aa AA seqDB search
MCGLIALRAHSALPDLSRIGRAALDTLSHRGPDDTDWLETDDAHPPTFLGHRRLSILDLS
SAGRQPMTCPVTGNSLVFNGEIYNFVELRHELQLAGCTFRTDTDTEVVLHAWRIWGEAAF
ARFNGMWALVLLERASGSLICCRDRLGVKPLYYARDNNGDRQLTILASEIRAIATVLGAY
PPPEPKTVFDFLMTGVSDHSRLTFYQGIRSVPPGWIIRLDCHGDLHSKPYHQWPETAPDN
RLDPEHLRELISDAVSVRLRSDAPSVTLLSGGLDSSIVTALAAKACRTESRSCHAGAYSY
GYRHGSAVEHDETARAAAFIAEHLPGTRHFTHLADALPTEAELMQLTRIQEEPIATPSVL
AGYRIFRGIRDDGFKVVLSGEGADEVFGGYTARYMSLLARDGIFAGRLLPAARLWRNGVV
TPGQLSNQLVWGLPPNVVRGLLRRTRPSALVMSPALWNAMAPEFSALYQDRRVDLEQRLR
RDVTATNLPMILRWTDRNSMHFGIEVRSPYLDWRVVSAALAAPISERMGDNHGKLALRRA
FSGQLPDDVVWRRKTHGFGNAEQFQVNNIRFEALWETLPAWAGDWLSLPDLRRELSRSGN
HTTLWWAVSLALWLAAIYGEGSGKAAR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattgattgccttgcgcgcccatagcgcgctgcccgacctgtcccgcatcgga
cgcgcggccctggataccctgtcgcaccgcgggccggacgacaccgattggctggagacc
gacgacgcccacccgccgacctttctcggccaccgccgcctgtccattctggatttaagc
agcgccggacgtcagcccatgacctgccctgtcaccggaaacagtctggtattcaatggt
gagatatacaacttcgtcgagctgcggcacgagctgcaactggcgggctgcacattccgc
acggacacggacaccgaagtcgttttgcacgcctggcgtatatggggcgaggcggctttc
gcgcgcttcaacggcatgtgggcgctggttctgctggaacgcgccagcggcagcttgatt
tgctgccgggaccgattgggcgttaagcccttgtactatgcccgagacaacaacggcgac
aggcagctgaccatactggccagcgaaattcgcgcaatcgctacggtactgggcgcttac
ccgccgcccgagcccaagacagtgttcgatttcctgatgaccggcgtgtccgaccatagc
cgcctcaccttctaccaaggtatccgctccgtgccgcccggttggatcatacgcttggat
tgccatggagacctgcacagcaaaccctatcatcagtggccggaaaccgccccggacaac
cgcctcgatccggaacacctgcgggaactgatctccgacgccgtaagcgtgcgactgcgt
tccgatgcgcccagcgttacgctgctgtcgggcgggttggacagttcgatcgtcacggca
ctggctgccaaagcctgccggacggaatcgcgcagttgccacgccggcgcctatagctac
ggttaccggcacggcagcgccgtcgaacacgacgaaaccgcgcgggccgccgccttcatc
gcagaacacttaccgggtactcgtcatttcacccacctcgccgacgcgttacccaccgag
gctgaattaatgcagctgacccgtattcaggaagaacccatcgccacgccctcggtattg
gccggctaccggatattccgcggcatccgcgacgacggcttcaaggtggttttgagcggc
gaaggcgcggacgaggtgttcggcggctacacagcccgttatatgagcctactggcgcgc
gacggaattttcgccggccggctgctgccggccgcgcggctgtggcgcaatggcgtggtc
acgccgggacaactcagcaatcaactggtgtggggtttaccccccaatgtcgtacgcggt
ctgctgcgtcgcacgcggcccagcgccctggtaatgagtccggctttatggaacgccatg
gcccccgagttttccgctctttatcaagaccggcgtgtcgacctggaacagcgcctgcgc
cgcgacgtaaccgcgaccaacctgcctatgatcctgcgctggaccgaccgcaacagcatg
catttcggtatcgaggtacgctccccctatctggactggcgcgtggtgtcggccgcgctg
gcggcccccatatccgagcgcatgggagacaatcacggcaagctcgccctgcgccgggcg
ttctccggccagctgcctgacgacgtggtatggcggcgcaaaacccacggtttcggcaac
gccgaacaatttcaggtcaacaatatccgttttgaagccttatgggaaacgctacccgcc
tgggcaggcgactggctatcgctaccggacctgcggcgcgaattgtcccgctccggcaac
cacaccacattatggtgggccgtatccctggcgctgtggttggccgcaatctacggcgaa
ggctcagggaaagccgcgcggtga

DBGET integrated database retrieval system