KEGG   Methylomonas methanica: Metme_3726Help
Entry
Metme_3726        CDS       T01511                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mmt  Methylomonas methanica
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metme_3726
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_3726
   00520 Amino sugar and nucleotide sugar metabolism
    Metme_3726
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Metme_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4135408..4136148
Genome map
AA seq 246 aa AA seqDB search
MHILGVDIGGSGIKGAVVDTVTGELITERHRIETPQPATPEAVAAVLAQLVLHFNWTGPV
GCGFPAAIQHGVARTASNISKAFIGTDIDSLFSEATNCPCYCVNDADAAGMAEMQFGEGA
GRPGVVLLVTIGTGLGSALFTDGHLIPNTELGHMYLDNGLEAERYASDAVRKVEDLGWKS
WGNRFNAFLTLMENLFWPDLIILGGGASKKFDKFKEQLKVEAPVKTAAFLNQAGIVGAAL
FAKSRL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatattctcggcgtggatattgggggttccggcattaaaggtgccgttgtggatacc
gtaacgggcgaattgataacagagcgccatagaatagagacgccccaacccgccacgccg
gaagcggtagccgcggttttggcgcaactggtcctgcattttaactggaccggcccggtt
ggctgcgggtttccggccgccattcaacacggtgtggcccgcaccgcatcgaatatttcc
aaagcgttcataggcaccgatatcgatagcttgttttcggaagccaccaactgtccctgc
tattgcgtcaacgacgcggacgccgccggcatggcggaaatgcaattcggcgagggcgca
gggcgacccggggtagtattactggtgaccataggcaccggtttgggatcggcgcttttt
acggacggccatttaatacccaataccgaactgggccatatgtatctggataacggtctg
gaagccgaacgttacgcctctgacgcggtgcgcaaagtcgaggatctcggctggaaatcc
tggggtaaccgcttcaatgccttcctgactttaatggaaaacctgttttggcccgacttg
attattctgggcggcggcgccagcaaaaaattcgacaaattcaaggaacagctgaaagta
gaagcgccggtaaaaaccgccgcgtttttaaatcaggcaggcattgtcggcgcggccttg
ttcgcaaaatccaggctctga

DBGET integrated database retrieval system