KEGG   Methylomonas methanica: Metme_3726Help
Entry
Metme_3726        CDS       T01511                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mmt  Methylomonas methanica
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mmt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmt00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mmt00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4135408..4136148
Genome map
AA seq 246 aa AA seqDB search
MHILGVDIGGSGIKGAVVDTVTGELITERHRIETPQPATPEAVAAVLAQLVLHFNWTGPV
GCGFPAAIQHGVARTASNISKAFIGTDIDSLFSEATNCPCYCVNDADAAGMAEMQFGEGA
GRPGVVLLVTIGTGLGSALFTDGHLIPNTELGHMYLDNGLEAERYASDAVRKVEDLGWKS
WGNRFNAFLTLMENLFWPDLIILGGGASKKFDKFKEQLKVEAPVKTAAFLNQAGIVGAAL
FAKSRL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatattctcggcgtggatattgggggttccggcattaaaggtgccgttgtggatacc
gtaacgggcgaattgataacagagcgccatagaatagagacgccccaacccgccacgccg
gaagcggtagccgcggttttggcgcaactggtcctgcattttaactggaccggcccggtt
ggctgcgggtttccggccgccattcaacacggtgtggcccgcaccgcatcgaatatttcc
aaagcgttcataggcaccgatatcgatagcttgttttcggaagccaccaactgtccctgc
tattgcgtcaacgacgcggacgccgccggcatggcggaaatgcaattcggcgagggcgca
gggcgacccggggtagtattactggtgaccataggcaccggtttgggatcggcgcttttt
acggacggccatttaatacccaataccgaactgggccatatgtatctggataacggtctg
gaagccgaacgttacgcctctgacgcggtgcgcaaagtcgaggatctcggctggaaatcc
tggggtaaccgcttcaatgccttcctgactttaatggaaaacctgttttggcccgacttg
attattctgggcggcggcgccagcaaaaaattcgacaaattcaaggaacagctgaaagta
gaagcgccggtaaaaaccgccgcgtttttaaatcaggcaggcattgtcggcgcggccttg
ttcgcaaaatccaggctctga

DBGET integrated database retrieval system