KEGG   Methylomonas methanica: Metme_3834Help
Entry
Metme_3834        CDS       T01511                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mmt  Methylomonas methanica
Pathway
mmt00900  Terpenoid backbone biosynthesis
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Metme_3834
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Metme_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEG02189
JGI: Metme_3834
UniProt: F9ZXN4
Position
complement(4247466..4248323)
Genome map
AA seq 285 aa AA seqDB search
MESIPGWGEKWPAPAKLNLMLRITGRRADGYHLLQTVFQMLDLCDWLTFYPKVDGSVSLL
NPIPGVPEQDDLTVRAANLLKLHTGCNAGVCIEIEKNLPMGGGLGGGSSDAATTLVVLNH
LWGLNLPKQALMALGLQLGADVPVFVFGHSAWGEGVGEKLQPIMPPEQWVVIIKPDCHVN
TKEIFCSEGLTRDSKVVKMSDFLAGEDRNDCTQEVCRIYQPVKDAIAALSVYADARLTGT
GACVFAQFSSKEDAETVAQSLKGEWQVFLAKGLNKSPLYKKLEQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatccccgggtggggcgagaaatggccagccccggcaaaattgaatttaatg
ttgagaattaccggtcgacgagcggatggatatcatttgctgcagactgtatttcaaatg
cttgatctatgtgattggttgacgttctatccgaaggttgacggtagtgtgtcgttgctg
aatccaattccaggcgtgccggagcaagatgatttgactgtgcgtgcggcgaatttactc
aagttgcacacggggtgtaatgccggggtttgcattgagattgaaaagaatttgcccatg
ggaggggggttaggtggtggcagttcggatgcggctactacgttggtggtgctgaatcat
ctctgggggttaaatctgcccaagcaggcgttaatggcgctgggtctgcagttgggggcg
gatgtcccggtctttgtgtttgggcattctgcgtggggggaaggtgtcggtgagaaatta
caaccgataatgcctccggagcaatgggtggttatcatcaagccggattgccacgtgaat
acaaaagaaattttttgttctgaagggttgacaagagatagtaaagtcgtcaaaatgagc
gactttcttgcaggggaagatcgaaatgattgtacccaagaggtttgcaggatttaccag
ccggtaaaagatgcgattgctgctttgtctgtgtacgcggatgcgaggttgacgggtacg
ggggcgtgtgtgtttgcgcaattttcgagcaaggaagatgctgagacggtggctcagtcg
ttaaaaggtgagtggcaggtgtttttggcaaaaggcttgaataaatcgccgctctacaag
aagttggaacaaggataa

DBGET integrated database retrieval system