KEGG   Methylomonas methanica: Metme_4085Help
Entry
Metme_4085        CDS       T01511                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mmt  Methylomonas methanica
Pathway
mmt00860  Porphyrin and chlorophyll metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
Module
mmt_M00121  Heme biosynthesis, glutamate => heme
mmt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metme_4085
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metme_4085
Exosome [BR:mmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metme_4085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEG02438
JGI: Metme_4085
UniProt: G0A0D2
Position
4504966..4505979
Genome map
AA seq 337 aa AA seqDB search
MEKMSHPKDFFPATRMRRMRYQAFSRRLMQENRLSSDDLISPLFVIEGHNRQESVASMPG
VNRLSLDLLLKEAEALLTLGIPAIALFPVVDSAQKSLDAGEAFNPDGLAQRSVRALKAAF
PELGVITDVALDPFTSHGQDGLINAQGYVVNDETVEVLCKQALSHAEAGADIVAPSDMMD
GRIGAIRQALENNNHINTRILAYSAKYASSFYGPFRDAVGSAGNLGGGNKYSYQMDPANS
DEAMREIALDLQEGADMIMVKPGMPYLDIIRRAKTEFGVPTFAYQVSGEYAMLKAAAQNG
WLDEKQVVMESLLAFKRAGCDAILTYFAKSAAQWLKQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatgtcacaccctaaagactttttcccagccacacgcatgcgaagaatgcgc
tatcaagcgttttcccgccgattaatgcaagaaaatcgtttatcctccgatgacttgatt
agtcccttattcgttatcgaaggccataatcgccaggaatcggtcgcctctatgccaggg
gttaaccgactgtccttggacttattactaaaggaagccgaagccttgctaacgctcggc
attcccgccattgccttgtttccggttgtagatagcgctcaaaaatccctggacgccggc
gaagcatttaacccggatggtctagctcaacgcagcgtcagggcgttaaaagccgctttt
cctgaattgggcgtcattaccgatgtggctttagaccctttcacttcgcatggacaggat
ggcttgatcaatgcccaaggttacgtcgtcaacgatgaaacggtggaagtattatgcaaa
caagccttatcgcacgccgaagccggggccgacatcgtcgccccgtccgacatgatggac
ggacgtattggcgccatcaggcaagccttggaaaacaacaatcatattaacaccagaatt
ctggcctattcggcaaaatacgcatccagtttctatggcccgttccgcgacgccgtcggc
tcggccggcaacctgggcggcggcaacaaatacagctaccagatggatccggccaattcc
gacgaagcgatgcgcgaaatcgccctggacttgcaagaaggcgcggacatgattatggtc
aagcccggcatgccctacctggatatcatacgtcgcgccaaaaccgaattcggcgttccg
accttcgcttatcaagtcagcggcgaatacgccatgctaaaagcagcggcgcaaaacggc
tggctggatgaaaaacaagtggtcatggaatcgttactggcatttaagcgcgcgggttgc
gacgccattttgacttatttcgccaagtcagctgcacaatggttaaaacaataa

DBGET integrated database retrieval system