KEGG   Methylomonas methanica: Metme_4085Help
Entry
Metme_4085        CDS       T01511                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmt  Methylomonas methanica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4504966..4505979
Genome map
AA seq 337 aa AA seqDB search
MEKMSHPKDFFPATRMRRMRYQAFSRRLMQENRLSSDDLISPLFVIEGHNRQESVASMPG
VNRLSLDLLLKEAEALLTLGIPAIALFPVVDSAQKSLDAGEAFNPDGLAQRSVRALKAAF
PELGVITDVALDPFTSHGQDGLINAQGYVVNDETVEVLCKQALSHAEAGADIVAPSDMMD
GRIGAIRQALENNNHINTRILAYSAKYASSFYGPFRDAVGSAGNLGGGNKYSYQMDPANS
DEAMREIALDLQEGADMIMVKPGMPYLDIIRRAKTEFGVPTFAYQVSGEYAMLKAAAQNG
WLDEKQVVMESLLAFKRAGCDAILTYFAKSAAQWLKQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatgtcacaccctaaagactttttcccagccacacgcatgcgaagaatgcgc
tatcaagcgttttcccgccgattaatgcaagaaaatcgtttatcctccgatgacttgatt
agtcccttattcgttatcgaaggccataatcgccaggaatcggtcgcctctatgccaggg
gttaaccgactgtccttggacttattactaaaggaagccgaagccttgctaacgctcggc
attcccgccattgccttgtttccggttgtagatagcgctcaaaaatccctggacgccggc
gaagcatttaacccggatggtctagctcaacgcagcgtcagggcgttaaaagccgctttt
cctgaattgggcgtcattaccgatgtggctttagaccctttcacttcgcatggacaggat
ggcttgatcaatgcccaaggttacgtcgtcaacgatgaaacggtggaagtattatgcaaa
caagccttatcgcacgccgaagccggggccgacatcgtcgccccgtccgacatgatggac
ggacgtattggcgccatcaggcaagccttggaaaacaacaatcatattaacaccagaatt
ctggcctattcggcaaaatacgcatccagtttctatggcccgttccgcgacgccgtcggc
tcggccggcaacctgggcggcggcaacaaatacagctaccagatggatccggccaattcc
gacgaagcgatgcgcgaaatcgccctggacttgcaagaaggcgcggacatgattatggtc
aagcccggcatgccctacctggatatcatacgtcgcgccaaaaccgaattcggcgttccg
accttcgcttatcaagtcagcggcgaatacgccatgctaaaagcagcggcgcaaaacggc
tggctggatgaaaaacaagtggtcatggaatcgttactggcatttaagcgcgcgggttgc
gacgccattttgacttatttcgccaagtcagctgcacaatggttaaaacaataa

DBGET integrated database retrieval system