KEGG   Methylomonas methanica: Metme_4114Help
Entry
Metme_4114        CDS       T01511                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmt  Methylomonas methanica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metme_4114
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metme_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4537157..4537939
Genome map
AA seq 260 aa AA seqDB search
MTLSLRGATVLVTRPAAQADTLCRLIAQADGRALRFPTLEIQPIDVDNALIEKALTCNWL
IFTSSNAVDFALKAFGGKMAGAMAVKLAAVGQATASALQKAGLQVTCVPKTEFSSEGLLA
QPAMQQVSGQRIVIVRGMGGREKLEHTLRGRGAEVAYLEVYRRCRPDIKCDELIQSLRNQ
QLNAITITSGEALQNLLTMLDPAAANLLRKQPLIVVSDRIRQLALELGFDQVAVSPQPTD
AAILETLTTLLNGENSGRSN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaagcctgcgcggcgcaaccgtattggtaacgcggcccgccgcccaggccgac
acgctgtgccgattgatcgcgcaagcggatgggcgggcgttacgattccccaccctggaa
attcaaccgatcgacgtcgataatgccttaattgaaaaagccttgacgtgcaattggttg
atttttaccagctccaatgcggtggattttgcgctgaaggcgttcggtggcaaaatggcg
ggtgctatggctgtaaaattagcggccgtcggccaagcaacggcgtctgccttgcaaaaa
gccggcttacaagtgacttgcgtaccgaaaacagaattcagcagcgaaggcctgctagct
caacctgccatgcaacaggtttccggccagcgcatcgtgatcgtgcgaggcatgggcggc
cgggaaaagttggagcacactttacgtggccgtggcgcggaagtggcatatctggaagtt
taccgtcgttgccgtccggatattaaatgcgatgaactgattcagtccttgcgaaatcaa
cagttgaacgctatcaccattaccagtggcgaagcactacaaaatctgttgaccatgctc
gacccggcagccgcgaatctgctgcgtaagcagcctttaatcgtggtgagcgacagaatc
aggcaattggcgcttgaactgggttttgatcaggttgcagtcagtccgcaaccaacggat
gcagcaattttagagacattgacgacgttattgaacggggaaaacagtggccgaagtaat
tga

DBGET integrated database retrieval system