KEGG   Methylomonas methanica: Metme_4114Help
Entry
Metme_4114        CDS       T01511                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmt  Methylomonas methanica
Pathway
mmt00860  Porphyrin and chlorophyll metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
Module
mmt_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metme_4114
Enzymes [BR:mmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metme_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEG02467
JGI: Metme_4114
UniProt: G0A0G1
Position
4537157..4537939
Genome map
AA seq 260 aa AA seqDB search
MTLSLRGATVLVTRPAAQADTLCRLIAQADGRALRFPTLEIQPIDVDNALIEKALTCNWL
IFTSSNAVDFALKAFGGKMAGAMAVKLAAVGQATASALQKAGLQVTCVPKTEFSSEGLLA
QPAMQQVSGQRIVIVRGMGGREKLEHTLRGRGAEVAYLEVYRRCRPDIKCDELIQSLRNQ
QLNAITITSGEALQNLLTMLDPAAANLLRKQPLIVVSDRIRQLALELGFDQVAVSPQPTD
AAILETLTTLLNGENSGRSN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaagcctgcgcggcgcaaccgtattggtaacgcggcccgccgcccaggccgac
acgctgtgccgattgatcgcgcaagcggatgggcgggcgttacgattccccaccctggaa
attcaaccgatcgacgtcgataatgccttaattgaaaaagccttgacgtgcaattggttg
atttttaccagctccaatgcggtggattttgcgctgaaggcgttcggtggcaaaatggcg
ggtgctatggctgtaaaattagcggccgtcggccaagcaacggcgtctgccttgcaaaaa
gccggcttacaagtgacttgcgtaccgaaaacagaattcagcagcgaaggcctgctagct
caacctgccatgcaacaggtttccggccagcgcatcgtgatcgtgcgaggcatgggcggc
cgggaaaagttggagcacactttacgtggccgtggcgcggaagtggcatatctggaagtt
taccgtcgttgccgtccggatattaaatgcgatgaactgattcagtccttgcgaaatcaa
cagttgaacgctatcaccattaccagtggcgaagcactacaaaatctgttgaccatgctc
gacccggcagccgcgaatctgctgcgtaagcagcctttaatcgtggtgagcgacagaatc
aggcaattggcgcttgaactgggttttgatcaggttgcagtcagtccgcaaccaacggat
gcagcaattttagagacattgacgacgttattgaacggggaaaacagtggccgaagtaat
tga

DBGET integrated database retrieval system