KEGG   Methylomonas methanica: Metme_4252Help
Entry
Metme_4252        CDS       T01511                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mmt  Methylomonas methanica
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Metme_4252
Enzymes [BR:mmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Metme_4252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4684557..4686923)
Genome map
AA seq 788 aa AA seqDB search
MTNTPLSMQETEVLNAYWRACNYLAAGMIYLRDNPLLKEPLKPEHIKQRLLGHWGASPGL
SFTYIHLNRLINRYDLNAIFLAGPGHGAPGVLAPVYLEGTYSEIYPNKSEDEEGLLNFFK
EFSFPGGIGSHCTPETPGSIHEGGELGYSISHAFGAAYDNPDLLVAVVVGDGESETAPLA
TSWHSNKFLNPIRDGAVLPILHLNGYKINNPTLLSRISHEELESLFKGYGWQPFFVEGSD
PMEMHGKMADAMEACVLEIRRIQQEARGSGKAVRPRWPMIVLRSPKGWTGPREVDGHKVE
GFWRSHQVPLSGVRENPAHLAQLEAWLRGYRPEELFDANGSLLPELKALAPQGQRRMSAN
LHANGGRLRKALCMPDFRNYRIEVTKPGTTSAENTRPLGKFLRDIMQENMQNFRVFGPDE
NTSNKLDDIYQVSKKTWLADYLPEDADGGQLAVDGRVMEMLSEHTLEGWLEGYLLTGRHG
FFSTYEAFVHVIDSMFNQHAKWLEMSKAVAWRAPISSLNLLITSTVWRQDHNGFTHQDPG
FLDVVVNKSPAVTRIYLPPDVNTLLAISDHCLQSTDYINVIVCDKQKHLQFLDMDAAIKH
CTKGIGIWEWASNDNGVEPDLVMACAGDIPTKEALAATVMLREHFPDLKVRFVNVVDLYK
LTPAAEHPHGLSDNDFDSLFTLDKPILFNFHGYPWLIHRLAYRRNNHKNLHVRGYKEKGS
INTPLELAIQNEIDRFSLVIDAIDRVPSLKVAGAHVKEKMRDMQIECRNYAYEYGADLPA
ADSWVWPY
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacgcctctctccatgcaagaaaccgaagtcctgaacgcctactggcgcgcc
tgcaattatctggccgccggcatgatttatttgcgggacaatcccttactaaaagagccg
ctaaaaccggagcatatcaagcaacgcctgctggggcattggggagccagtccgggtctg
agctttacctatatccatctgaaccgcttgatcaatcgatacgacctgaatgccattttt
ctggccggtcccgggcatggcgcgccgggagttttggcaccggtttatctggaagggact
tacagcgagatttatcccaacaaaagcgaagacgaagaaggtttgttgaacttctttaaa
gaattttcctttccgggcggcatcggcagccattgcacgccggaaacgccgggatccata
catgagggaggtgagttgggctacagcatttcccatgctttcggtgccgcctacgacaat
cctgacttgttggttgccgtcgttgtcggtgacggcgaatccgaaaccgcgccgctggct
acctcctggcattccaataaattcctcaaccctattcgcgatggggcggtattgccgatc
ctacatttgaacggctacaagataaacaaccccacgttgctgtcgcgcatcagtcatgaa
gagttggaaagcttgttcaaaggttacggatggcagccgtttttcgtggaaggcagtgat
cccatggagatgcacggcaaaatggccgatgccatggaggcctgtgtattggagattcgt
cggatacagcaggaggcgcgcggcagcggcaaggcagtgcggccgcgttggccgatgata
gtgttgcgttcgcccaagggttggacaggccctagggaagtcgacggccacaaagtggaa
ggtttttggcgctcccatcaagtacctctgagcggtgtgcgggaaaatcccgcccacctg
gcgcaattggaagcctggctgcgcggttaccggccggaagaattattcgacgctaacggt
agtctgttacccgaactaaaagccctggctccgcagggacaacgtcgaatgagcgccaat
ctgcatgccaacggcgggcgtttgcgcaaagcgctgtgcatgccggactttcggaattac
cgcatcgaagtgaccaaacccggtaccaccagcgccgaaaatactcggccgctaggcaag
tttttgcgcgatatcatgcaggaaaacatgcagaattttcgggtattcggcccggatgaa
aatacttccaataaactggacgacatctatcaagtcagtaagaaaacctggctggccgat
tatttgccggaggatgccgatggtggtcaattggcggtcgacggcagggttatggaaatg
ctatcggaacataccttggaaggctggctggaaggctatctgctcaccggtcgacacggt
ttcttttcgacttacgaagcgtttgtacatgtgattgattcgatgttcaatcagcatgcc
aaatggctggaaatgtccaaggccgtagcttggcgggcgccgatttcgtcattgaattta
ttgattacctctacggtttggcggcaggatcacaatggctttactcatcaggatcccggc
tttctggatgtcgtggtgaataaaagcccggctgtgacgcgcatttacctgccacccgac
gtcaataccctgttggcgatcagcgaccattgcctgcaaagcaccgattacatcaacgtc
atcgtctgcgacaaacaaaaacacttgcagtttctggacatggacgcggcgatcaagcat
tgcaccaagggtataggcatttgggaatgggccagcaacgacaacggcgtcgagccggat
ttggtaatggcctgcgccggcgatattcccaccaaggaagctttggcggcaacggtgatg
ttgcgggagcattttccggatttgaaagtacggttcgtaaacgtcgtggatttgtacaaa
ctgactcctgctgccgagcatccgcacgggttgtctgataacgatttcgatagtctgttt
acgctggacaagccgattctgttcaattttcacggctatccctggttgatccatcgtctg
gcataccggcgcaataatcacaaaaacctgcacgtgcgcggctacaaggaaaaaggcagt
atcaatacgccgctggaattggcgattcaaaacgaaatcgaccggtttagtttggtgatc
gacgctatcgaccgggtgccgtcactaaaggtggcgggtgcgcatgtcaaagaaaaaatg
cgcgatatgcagatcgaatgccgtaattacgcctacgaatacggcgcggatctgccggcg
gcggatagctgggtttggccatactga

DBGET integrated database retrieval system