KEGG   Methylomonas methanica: Metme_4402Help
Entry
Metme_4402        CDS       T01511                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mmt  Methylomonas methanica
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Metme_4402
   00240 Pyrimidine metabolism
    Metme_4402
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Metme_4402
   03430 Mismatch repair
    Metme_4402
   03440 Homologous recombination
    Metme_4402
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Metme_4402
DNA replication proteins [BR:mmt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Metme_4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4833809..4834273
Genome map
AA seq 154 aa AA seqDB search
MPEVVFYVLASSSQHQRQDFACKLIEKIYRGGQFCYVLTEHAEQAAEIDKLLWTFRPGSF
VPHQVYGNQLPAYQNTILIGDNAVPEHWQKIIINLSSHFPPTIAPTERIVEILDNSEESK
QAGRQRYKHYLEAGLEIVTHKNEGGVWLETRAGG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaagtagtcttttacgtcctggcctccagctcccaacatcagcgtcaggatttc
gcctgcaaattgatcgaaaagatctatcgcggcggccaattttgctatgtattaaccgag
catgccgaacaggctgctgaaatcgataagttattgtggacatttcggcccggcagtttc
gtgccccatcaggtgtatggcaatcagctacccgcctatcaaaacaccatcctgataggc
gacaacgcggtcccggagcactggcaaaaaatcatcatcaatttatccagccacttcccg
cccacgattgctcccaccgagcgcatcgtggaaatactggataacagcgaagaaagcaag
caggcaggccgccagcgctacaaacattacctggaagcagggctggaaattgttactcat
aagaacgagggcggggtttggctggaaacacgggcaggcggctga

DBGET integrated database retrieval system