KEGG   Methylomonas methanica: Metme_4466Help
Entry
Metme_4466        CDS       T01511                                 

Definition
aldose-1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mmt  Methylomonas methanica
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmt00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4900637..4901542)
Genome map
AA seq 301 aa AA seqDB search
MDFQQLNSDFGIPRQLEIIPGPGGMPMIKVDNGSARALISLYGGQVLSFQPLEQAEDVLF
LSGQSAYTEGKAIRGGIPVCWPWFGPDPKGLQRPNHGFVRNHFWQLTKTEAVSDSETTVS
LRFTDRFKQENTWRKPFLLMLDISIGPILRLKLTTCNTGNEPFSITQVFHSYFRVGDIKR
VQVLGLEDCDYFDKLDQGIQKTQKGIVTVAREVDRVYVEAYKNLVIVDPVLKRRIHINSP
NTSTAVVWNPWLKTSKKMSDLADTDYQRFICVEAGNVAFDLIQVQPGSQFSLQANYSLLP
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggattttcagcagttaaacagtgatttcggaatacccaggcagctggagattattcca
ggcccaggcggtatgccgatgattaaagtcgacaatggcagcgccagggcgttaatttcg
ctatacggcgggcaggtattgtcgtttcagcctctggagcaagccgaggatgtgctgttt
ctgagcggacagtcggcctatacggaaggcaaggcgatacgcggcggcattccggtgtgc
tggccctggttcgggccggacccgaaaggtttgcagcgtcccaatcacggtttcgtacgc
aatcatttttggcagctgaccaagacggaggccgtcagcgatagcgagaccacggtcagt
ttaaggtttaccgaccgttttaaacaggaaaatacctggcgaaaaccgtttttattgatg
ttggacatcagcataggcccaatcctgcgattaaagttgactacttgtaataccggcaat
gaacccttttccattactcaggtgtttcatagttattttcgggttggtgacatcaaacgg
gtgcaagtattaggcctggaagattgcgattactttgataagctggatcaaggtatacaa
aaaacgcagaaaggaatcgttactgtcgcgcgggaagtggatagagtttacgtcgaagct
tacaaaaacctggtgattgtcgatccggtgttaaagcgccgaatccacatcaactcaccc
aataccagtacggcagtggtgtggaatccctggttgaaaacgtctaaaaagatgtcggat
ttagcggatacggattatcagcgatttatttgtgttgaagcggggaatgtcgctttcgac
ctgatccaggttcaacccggcagtcaatttagcctgcaggccaattacagtctattgccg
gattaa

DBGET integrated database retrieval system