KEGG   Methylomonas methanica: Metme_4551Help
Entry
Metme_4551        CDS       T01511                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmt  Methylomonas methanica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mmt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4987581..4988063)
Genome map
AA seq 160 aa AA seqDB search
MKISLIVAMASNRVIGLNGMMPWHLSADLKRFKQITLGSPIMMGRKTFDAIGRPLPGREN
LIISRNPDYRQPGCRIFADIDGALEYAQVCPEVFVIGGATLYEALLPQADFVYLTLIHRE
FAGDTYFPEIDYSAWRTLERVEVTDDPAVDFSYSFLKLAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcactgatcgtcgccatggccagtaaccgggtcattggtttgaacggaatg
atgccttggcatttgtccgcggatttaaagcgcttcaaacaaattaccttgggctcgccc
attatgatgggacgtaaaacttttgatgccataggcaggccgctgccgggccgggaaaat
ctcatcatcagccgtaatccggattaccgacagccgggctgccggattttcgccgatatt
gatggcgcgttagagtatgctcaggtatgtccggaagtctttgtaatcggcggtgccacg
ctttatgaagcattgctgccgcaagcggattttgtttatttaaccctgattcatcgggaa
tttgccggcgatacctactttccggagatagactattcggcttggcggaccttggagcgg
gtcgaggtgaccgatgatccggccgtggatttttcgtatagttttctgaagttagcgcgt
tga

DBGET integrated database retrieval system