KEGG   Methylomonas methanica: Metme_4551Help
Entry
Metme_4551        CDS       T01511                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mmt  Methylomonas methanica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metme_4551
   00670 One carbon pool by folate
    Metme_4551
Enzymes [BR:mmt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Metme_4551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4987581..4988063)
Genome map
AA seq 160 aa AA seqDB search
MKISLIVAMASNRVIGLNGMMPWHLSADLKRFKQITLGSPIMMGRKTFDAIGRPLPGREN
LIISRNPDYRQPGCRIFADIDGALEYAQVCPEVFVIGGATLYEALLPQADFVYLTLIHRE
FAGDTYFPEIDYSAWRTLERVEVTDDPAVDFSYSFLKLAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcactgatcgtcgccatggccagtaaccgggtcattggtttgaacggaatg
atgccttggcatttgtccgcggatttaaagcgcttcaaacaaattaccttgggctcgccc
attatgatgggacgtaaaacttttgatgccataggcaggccgctgccgggccgggaaaat
ctcatcatcagccgtaatccggattaccgacagccgggctgccggattttcgccgatatt
gatggcgcgttagagtatgctcaggtatgtccggaagtctttgtaatcggcggtgccacg
ctttatgaagcattgctgccgcaagcggattttgtttatttaaccctgattcatcgggaa
tttgccggcgatacctactttccggagatagactattcggcttggcggaccttggagcgg
gtcgaggtgaccgatgatccggccgtggatttttcgtatagttttctgaagttagcgcgt
tga

DBGET integrated database retrieval system