KEGG   Mus musculus (mouse): 100038882Help
Entry
100038882         CDS       T01002                                 

Gene name
Isg15, G1p2, IGI15, IP17, Irfp, UCRP
Definition
ISG15 ubiquitin-like modifier
Orthology
K12159  
ubiquitin cross-reactive protein
Organism
mmu  Mus musculus (mouse)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100038882 (Isg15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
4 E2; 4
AA seq 161 aa AA seqDB search
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggacctaaaggtgaagatgctggggggtaacgatttcctggtgtccgtgact
aactccatgacggtgtcagaactgaagaagcagattgcccagaagattggtgtgccggct
ttccagcagcgcctggcccaccaaactgcagtgctccaggacggtcttaccctttccagt
ctgggtctgggtcccagcagcacagtgatgctagtggtacagaactgcagcgagcctctg
agcatcctggtgaggaacgaaaggggccacagcaacatctatgaggtctttctgacgcag
actgtagacacgcttaagaagaaggtgtcccagcgggaacaagtccacgaagaccagttc
tggctgagcttcgagggaaggcccatggaggacaaggagctgctgggggagtatggccta
aagccccagtgcacagtgatcaagcatttgcgcctgaggggtgggggaggggaccagtgt
gcctaa

DBGET integrated database retrieval system