KEGG   Mus musculus (mouse): 100038882Help
Entry
100038882         CDS       T01002                                 

Gene name
Isg15, G1p2, IGI15, IP17, Irfp, UCRP
Definition
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100038882 (Isg15)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100038882 (Isg15)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100038882 (Isg15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD UN_NPL4 Ubiquitin_2 RAWUL DUF2407 TUG-UBL1
Motif
Other DBs
NCBI-GeneID: 100038882
NCBI-ProteinID: NP_056598
MGI: 1855694
Ensembl: ENSMUSG00000035692
UniProt: Q64339 Q4FJR9
Structure
PDB: 

Jmol
Position
4 E2; 4
AA seq 161 aa AA seqDB search
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggacctaaaggtgaagatgctggggggtaacgatttcctggtgtccgtgact
aactccatgacggtgtcagaactgaagaagcagattgcccagaagattggtgtgccggct
ttccagcagcgcctggcccaccaaactgcagtgctccaggacggtcttaccctttccagt
ctgggtctgggtcccagcagcacagtgatgctagtggtacagaactgcagcgagcctctg
agcatcctggtgaggaacgaaaggggccacagcaacatctatgaggtctttctgacgcag
actgtagacacgcttaagaagaaggtgtcccagcgggaacaagtccacgaagaccagttc
tggctgagcttcgagggaaggcccatggaggacaaggagctgctgggggagtatggccta
aagccccagtgcacagtgatcaagcatttgcgcctgaggggtgggggaggggaccagtgt
gcctaa

DBGET integrated database retrieval system