KEGG   Mus musculus (mouse): 100043771Help
Entry
100043771         CDS       T01002                                 

Gene name
Gm10651
Definition
predicted pseudogene 10651
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100043771 (Gm10651)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C86
   100043771 (Gm10651)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
7 A3; 7
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKAESSDLPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKYHLRGK
NCELLLVVPEEVEAHQSWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcgtgccatggaaaggagacaaggccaaagctgaatcctcggaccttccccaa
gcagcacccccacaaatctaccatgagaagcagcgcagggagctctgtgctcttcatgct
ctcaacaacgtcttccaggacagcaacgccttcacgcgggaaacgctgcaggagattttc
cagaggctgtctccgaacactatggtgacgccccacaagaagagcatgctgggaaatggg
aactatgatgtgaatgtcatcatggcagcacttcaaaccaaaggctatgaagctgtttgg
tgggacaagcgaagggacgtgggtgtcattgctcttactaatgtcatgggcttcatcatg
aacctgccctccagcctctgctggggtccactcaagttgcctctcaaaaggcagcactgg
atctgtgttcgtgaggtgggaggggcctactacaaccttgactccaaactcaagatgcca
gagtggattggaggcgagagtgagctcaggaaatttctaaaataccatttgcgaggtaaa
aactgtgaactcctactggttgtaccggaagaagtggaagcccatcagagctggagggcc
gacgtgtga

DBGET integrated database retrieval system