KEGG   Mus musculus (mouse): 100066Help
Entry
100066            CDS       T01002                                 

Gene name
Cyp2j11, AI314783, Cyp2j11-ps
Definition
cytochrome P450, family 2, subfamily j, polypeptide 11
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100066 (Cyp2j11)
   00591 Linoleic acid metabolism
    100066 (Cyp2j11)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100066 (Cyp2j11)
  Nervous system
   04726 Serotonergic synapse
    100066 (Cyp2j11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100066 (Cyp2j11)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100066 (Cyp2j11)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   100066 (Cyp2j11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C5; 4
AA seq 504 aa AA seqDB search
MLAIATCLVANICSAIHLWTLLLTLLTLLLLADYLKNRRPKNYPPGPRRLPFVGNLFQFD
LDVSRLHLGIQPFVKKYGNVISVNFGYISSVIISGLPLIKEAITGMEQNFLKRPSLAARQ
HVFKNNGIVFSSGQTWKEQRKFALTILKNFGLGKKSLEQCIQEEAYHLVKAIGEEKGQPF
DPHFRINNAVGNIICSIIFGERFEYDDNQFQELLKLADEIICSEASMMSVLYNVFPSIFK
YLPGPQQKLFSNWEKLKLFVSRMMDSHREDWNPSAPRDFIDAFLTEMTKYPDKTTTSFNE
ENLICTALDLFFAGTETTSNTLRWALLYITVNPEVQEKVHSEIDRVIGHGRHPTLDDQDS
MPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFYLPKGTMVLINLTDLHRDPKEWDTP
NVFNPEHFLENGQFKKKESFLPFSMGKRACPGEQLASCELFIFFTALMQKFTFKSPINEK
PSLKFRMGLTLAPVSYRICAVPRL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctattgcaacttgcctggtggctaacatctgctcagcaatccatctctggact
ctgcttctcactcttcttaccttgctgctccttgctgactacctcaaaaacaggcgcccc
aagaactatcctccagggcccaggcgcctgccatttgtgggcaacttgttccagtttgat
ttagatgtgtcacgtctgcatttggggatccagccgtttgtgaagaagtatggaaacgta
attagcgtgaattttggttacatttcttcagtgatcataagtggactgcccttaatcaaa
gaagctatcactggcatggaacaaaactttttgaaacgccccagtttagctgcaaggcaa
catgtatttaaaaataatggcattgttttttctagtggccagacatggaaggagcaaaga
aagttcgcactgacaatactcaagaattttggattagggaagaagagcttggagcagtgt
atacaagaagaggcttaccatcttgtgaaggccataggagaggagaaaggacagcctttt
gaccctcacttcaggatcaacaatgctgttggcaacatcatttgctccatcatctttggg
gagcgctttgagtatgatgacaatcagtttcaggagctactgaagttagcagatgaaatc
atatgttctgaggcatcaatgatgtcagtgctctacaatgtcttcccatccatatttaaa
tatcttcctggaccacaacaaaaactgtttagcaactgggaaaaactgaaattgtttgtt
tcccgtatgatggacagtcaccgggaagattggaatccttctgcaccaagagacttcatt
gatgctttccttacagaaatgacaaagtacccagacaagactactacaagttttaatgaa
gaaaatctcatctgcactgctctggacctcttctttgctggaacagagacaacatctaac
acactgcgctgggctctcctctatataactgttaacccagaagtgcaagaaaaagtacac
tctgagattgacagagtgattggacatgggagacacccaaccttagatgaccaagactcc
atgccctacaccaatgctgtcatccatgaggtgctgaggatgggcaacatcatccccttg
aatgttcccagagaagtaacagctgatagcacactggctggattctacctgcctaagggc
accatggttctgatcaatttgactgatctgcatagggaccccaaagagtgggacactcca
aatgtcttcaatccagagcactttttagagaatgggcagtttaagaagaaagaatccttt
ctgcctttctcaatgggaaagagagcttgccctggggaacaattggccagttgtgaactg
ttcattttcttcactgctcttatgcaaaaatttacattcaagtccccaatcaatgagaag
ccgagcctgaagttcagaatgggcctaacacttgccccagtcagctaccggatctgtgcg
gtccctagattgtga

DBGET integrated database retrieval system