KEGG   Mus musculus (mouse): 100066Help
Entry
100066            CDS       T01002                                 

Gene name
Cyp2j11, AI314783, Cyp2j11-ps
Definition
cytochrome P450, family 2, subfamily j, polypeptide 11
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mmu00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mmu04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mmu04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mmu04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C5; 4
AA seq 504 aa AA seqDB search
MLAIATCLVANICSAIHLWTLLLTLLTLLLLADYLKNRRPKNYPPGPRRLPFVGNLFQFD
LDVSRLHLGIQPFVKKYGNVISVNFGYISSVIISGLPLIKEAITGMEQNFLKRPSLAARQ
HVFKNNGIVFSSGQTWKEQRKFALTILKNFGLGKKSLEQCIQEEAYHLVKAIGEEKGQPF
DPHFRINNAVGNIICSIIFGERFEYDDNQFQELLKLADEIICSEASMMSVLYNVFPSIFK
YLPGPQQKLFSNWEKLKLFVSRMMDSHREDWNPSAPRDFIDAFLTEMTKYPDKTTTSFNE
ENLICTALDLFFAGTETTSNTLRWALLYITVNPEVQEKVHSEIDRVIGHGRHPTLDDQDS
MPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFYLPKGTMVLINLTDLHRDPKEWDTP
NVFNPEHFLENGQFKKKESFLPFSMGKRACPGEQLASCELFIFFTALMQKFTFKSPINEK
PSLKFRMGLTLAPVSYRICAVPRL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctattgcaacttgcctggtggctaacatctgctcagcaatccatctctggact
ctgcttctcactcttcttaccttgctgctccttgctgactacctcaaaaacaggcgcccc
aagaactatcctccagggcccaggcgcctgccatttgtgggcaacttgttccagtttgat
ttagatgtgtcacgtctgcatttggggatccagccgtttgtgaagaagtatggaaacgta
attagcgtgaattttggttacatttcttcagtgatcataagtggactgcccttaatcaaa
gaagctatcactggcatggaacaaaactttttgaaacgccccagtttagctgcaaggcaa
catgtatttaaaaataatggcattgttttttctagtggccagacatggaaggagcaaaga
aagttcgcactgacaatactcaagaattttggattagggaagaagagcttggagcagtgt
atacaagaagaggcttaccatcttgtgaaggccataggagaggagaaaggacagcctttt
gaccctcacttcaggatcaacaatgctgttggcaacatcatttgctccatcatctttggg
gagcgctttgagtatgatgacaatcagtttcaggagctactgaagttagcagatgaaatc
atatgttctgaggcatcaatgatgtcagtgctctacaatgtcttcccatccatatttaaa
tatcttcctggaccacaacaaaaactgtttagcaactgggaaaaactgaaattgtttgtt
tcccgtatgatggacagtcaccgggaagattggaatccttctgcaccaagagacttcatt
gatgctttccttacagaaatgacaaagtacccagacaagactactacaagttttaatgaa
gaaaatctcatctgcactgctctggacctcttctttgctggaacagagacaacatctaac
acactgcgctgggctctcctctatataactgttaacccagaagtgcaagaaaaagtacac
tctgagattgacagagtgattggacatgggagacacccaaccttagatgaccaagactcc
atgccctacaccaatgctgtcatccatgaggtgctgaggatgggcaacatcatccccttg
aatgttcccagagaagtaacagctgatagcacactggctggattctacctgcctaagggc
accatggttctgatcaatttgactgatctgcatagggaccccaaagagtgggacactcca
aatgtcttcaatccagagcactttttagagaatgggcagtttaagaagaaagaatccttt
ctgcctttctcaatgggaaagagagcttgccctggggaacaattggccagttgtgaactg
ttcattttcttcactgctcttatgcaaaaatttacattcaagtccccaatcaatgagaag
ccgagcctgaagttcagaatgggcctaacacttgccccagtcagctaccggatctgtgcg
gtccctagattgtga

DBGET integrated database retrieval system