KEGG   Mus musculus (mouse): 100502876Help
Entry
100502876         CDS       T01002                                 

Gene name
Kcnmb3, EG435726, Gm5707
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100502876 (Kcnmb3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100502876 (Kcnmb3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100502876 (Kcnmb3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100502876 (Kcnmb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 A3; 3
AA seq 239 aa AA seqDB search
MQPFSIPVQITLQGGRRRQGRTALPASGKINGDPLKVHPKLPSSAGEDRAMLLGVAMMAS
SVLMFFLLGTTVLKPFMLRSPREESNCTTVHTHIVDDGLDFSFTCEGSCQDHGRSPCLQV
FVNLSHSGQKVLLHYDDEAIRTNPKCFYTPKCHGDRDDLLNSVLDIKEFFDHNNGTFPCF
YSPDGPLGVVLRKSGHKVVFHCLFWPLLTLLGGALIVGLVRLTQHLSFQCEQYSTVVRA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccctgtccaaatcacgctacagggtggccggaggcgccaaggg
aggacagcacttccggcctcgggcaaaatcaatggagatcccctgaaggtgcacccaaag
cttccatcaagcgctggtgaggaccgggccatgctgctgggcgtggccatgatggcttcc
tctgtactgatgttcttcctgttggggaccactgtgttgaagcccttcatgctcagatct
cccagagaagaatcaaactgcaccactgtccacacacacattgtggatgacgggctggac
ttttccttcacctgtgagggtagctgccaggaccacgggagatccccatgcctgcaggtg
ttcgtaaacctgagccactcgggacagaaagtgcttctccactacgacgacgaggccatc
aggaccaaccccaagtgcttttacacacccaagtgtcacggagaccgggatgatctgctc
aacagcgtcctggacatcaaggaattcttcgatcacaacaatggaactttcccctgtttc
tacagtcccgatggccccttgggagttgttctgaggaagtctggccacaaggttgtcttt
cactgcttattttggcctttattgactttgctgggaggcgccctgattgttggcttggtt
aggctaacacaacatctgtcctttcagtgtgaacagtacagcacagtggtaagagcttaa

DBGET integrated database retrieval system