KEGG   Mus musculus (mouse): 100502876Help
Entry
100502876         CDS       T01002                                 

Gene name
Kcnmb3, EG435726, Gm5707
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:mmu04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mmu04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 A3; 3
AA seq 239 aa AA seqDB search
MQPFSIPVQITLQGGRRRQGRTALPASGKINGDPLKVHPKLPSSAGEDRAMLLGVAMMAS
SVLMFFLLGTTVLKPFMLRSPREESNCTTVHTHIVDDGLDFSFTCEGSCQDHGRSPCLQV
FVNLSHSGQKVLLHYDDEAIRTNPKCFYTPKCHGDRDDLLNSVLDIKEFFDHNNGTFPCF
YSPDGPLGVVLRKSGHKVVFHCLFWPLLTLLGGALIVGLVRLTQHLSFQCEQYSTVVRA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccctgtccaaatcacgctacagggtggccggaggcgccaaggg
aggacagcacttccggcctcgggcaaaatcaatggagatcccctgaaggtgcacccaaag
cttccatcaagcgctggtgaggaccgggccatgctgctgggcgtggccatgatggcttcc
tctgtactgatgttcttcctgttggggaccactgtgttgaagcccttcatgctcagatct
cccagagaagaatcaaactgcaccactgtccacacacacattgtggatgacgggctggac
ttttccttcacctgtgagggtagctgccaggaccacgggagatccccatgcctgcaggtg
ttcgtaaacctgagccactcgggacagaaagtgcttctccactacgacgacgaggccatc
aggaccaaccccaagtgcttttacacacccaagtgtcacggagaccgggatgatctgctc
aacagcgtcctggacatcaaggaattcttcgatcacaacaatggaactttcccctgtttc
tacagtcccgatggccccttgggagttgttctgaggaagtctggccacaaggttgtcttt
cactgcttattttggcctttattgactttgctgggaggcgccctgattgttggcttggtt
aggctaacacaacatctgtcctttcagtgtgaacagtacagcacagtggtaagagcttaa

DBGET integrated database retrieval system