KEGG   Mus musculus (mouse): 100705Help
Entry
100705            CDS       T01002                                 

Gene name
Acacb, AI597064, AW743042, Acc2, Accb
Definition
acetyl-Coenzyme A carboxylase beta (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100705 (Acacb)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100705 (Acacb)
   00640 Propanoate metabolism
    100705 (Acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100705 (Acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100705 (Acacb)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100705 (Acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100705 (Acacb)
   04920 Adipocytokine signaling pathway
    100705 (Acacb)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100705 (Acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100705 (Acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5
AA seq 2448 aa AA seqDB search
MVLLLFLTCLVFSCLTFSWLKIWGKMTDSKPLTNSKVEANLLSSEESLSASELSGEQLQE
HGDHSCLSYRGPRDASQQRNSLPSSCQRPPRNPLSSNDTWPSPELQTNWTAAPGPEVPDA
NGLSFPARPPSQRTVSPSREDRKQAHIKRQLMTSFILGSLDDNSSDEDPSAGSFQNSSRK
SSRASLGTLSQEAALNTSDPESHAPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEF
VTRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEY
IKMADQYVPVPGGPNNNNYANVELIIDIAKRIPVQAVWAGWGHASENPKLPELLCKHEIA
FLGPPSEAMWALGDKIASTIVAQTLQIPTLPWSGSGLTVEWTEDSRHQGKCISVPEDVYE
QGCVKDVDEGLQAAEKIGFPLMIKASEGGGGKGIRKAESAEDFPMLFRQVQSEIPGSPIF
LMKLAQNARHLEVQVLADQYGNAVSLFGRDCSIQRRHQKIIEEAPATIAAPAVFEFMEQC
AVLLAKMVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMG
VPLHRLKDIRLLYGESPWGVTPIPFETPLSPPIARGHVIAARITSENPDEGFKPSSGTVQ
ELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDF
RTTVEYLVNLLETESFQNNDIDTGWLDHLIAQRVQAEKPDIMLGVVCGALNVADAMFRTC
MTEFLHSLERGQVLPADSLLNIVDVELIYGGIKYALKVARQSLTMFVLIMNGCHIEIDAH
RLNDGGLLLSYNGSSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLMQYTV
EDGDHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGVILEAGCVVARLELDDPSKVH
AAQPFTGELPAQQTLPILGEKLHQVFHGVLENLTNVMSGYCLPEPFFSMKLKDWVQKLMM
TLRHPSLPLLELQEIMTSVAGRIPAPVEKAVRRVMAQYASNITSVLCQFPSQQIATILDC
HAATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMKAVVLDLLRKYLNVEHHFQQAHYD
KCVINLREQFKPDMTQVLDCIFSHSQVAKKNQLVTMLIDELCGPDPTLSDELTSILCELT
QLSRSEHCKVALRARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCPENLKKLILSE
TTIFDVLPTFFYHENKVVCMASLEVYVRRGYIAYELNSLQHRELPDGTCVVEFQFMLPSS
HPNRMAVPISVSNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEEFTRNFDEVISCFA
NVQTDTLLFSKACTSLYSEEDSKSLREEPIHILNVAIQCADHMEDEALVPVFRAFVQSKK
HILVDYGLRRITFLVAQEREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRNFDL
TAVPCANHKMHLYLGAAKVKEGLEVTDHRFFIRAIIRHSDLITKEASFEYLQNEGERLLL
EAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPLKIEESVRDMVMRYGSRLWKLRVLQA
EVKINIRQTTSDSAIPIRLFITNESGYYLDISLYREVTDSRSGNIMFHSFGNKQGSLHGM
LINTPYVTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGSPEKYPKDILTYTELVL
DSQGQLVEMNRLPGCNEVGMVAFKMRFKTPEYPEGRDAVVIGNDITFQIGSFGIGEDFLY
LRASEMARTEGIPQIYLAANSGARMGLAEEIKQIFQVAWVDPEDPHKGFRYLYLTPQDYT
QISSQNSVHCKHIEDEGESRYVIVDVIGKDANLGVENLRGSGMIAGEASLAYEKTVTISM
VTCRALGIGAYLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHTNG
VSHVTVPDDFEGVCTILEWLSFIPKDNRSPVPITTPSDPIDREIEFTPTKAPYDPRWMLA
GRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVETRTVEVAVPA
DPANLDSEAKIIQQAGQVWFPDSAYKTAQVIRDFNKERLPLMIFANWRGFSGGMKDMYEQ
MLKFGAYIVDGLRLYEQPILIYIPPCAELRGGSWVVLDSTINPLCIEMYADKESRGGVLE
PEGTVEIKFRKKDLVKTIRRIDPVCKKLVGQLGKAQLPDKDRKELEGQLKAREELLLPIY
HQVAVQFADLHDTPGHMLEKGIISDVLEWKTARTFFYWRLRRLLLEAQVKQEILRASPEL
NHEHTQSMLRRWFVETEGAVKAYLWDSNQVVVQWLEQHWSAKDGLRSTIRENINYLKRDS
VLKTIQSLVQEHPEVIMDCVAYLSQHLTPAERIQVAQLLSTTESPASS
NT seq 7347 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgcttctctttctgacttgcctggttttctcctgcctgaccttttcctggcta
aaaatctgggggaagatgacagactcgaagccgctcaccaacagtaaggtggaagccaat
ctcctttcaagcgaggagtccctttcagcctcagagctgtcaggggaacagctgcaggaa
catggcgaccacagctgtctgtcctacagaggtcccagagacgccagtcagcagaggaac
tccctgccaagctcatgccagaggcctccgaggaacccactgtcttccaatgacacctgg
ccctccccagaactccaaaccaactggacagccgccccgggcccagaggttccagatgct
aatgggttgtccttcccagccaggcccccgagccagaggacagtatccccctccagagag
gacaggaagcaggcacacatcaagagacagctgatgaccagctttatcctgggctccctg
gatgacaactcctctgatgaggaccctagtgccggctccttccagaactcctcccggaag
agcagcagggctagcctgggcactctgtcccaggaggctgcattgaacacaagtgatcct
gaatctcacgcgcctactatgaggcccagcatgtctggactccatctggtgaagagaggc
cgagaacacaagaaactggacctgcacagagatttcaccgtcgcgtccccagccgagttt
gtcactcggtttggaggcaacagggtcatagagaaggtgctcatcgccaacaatggcatc
gctgcggtcaagtgtatgcgctccatccgccgctgggcctacgagatgttccgtaatgaa
cgtgccatccggttcgtggtcatggtgacgcccgaggatctgaaggccaacgcagagtac
atcaagatggccgatcagtacgtccctgtcccaggaggacccaataacaacaactatgcc
aatgttgagctgatcatagacattgccaagagaatccctgtacaggccgtgtgggctggc
tggggccacgcttcggaaaaccccaaacttccagagctgctgtgtaaacacgagattgct
ttcctaggtccccccagtgaggccatgtgggccctgggagacaagatcgcctccaccatc
gtagcgcagacactgcaaatcccaaccttaccctggagtggaagcggtctcacagtggag
tggacggaggacagccggcaccagggcaaatgcatcagtgtccccgaagacgtttacgag
cagggctgtgtgaaggatgtggacgaaggcttgcaggcagcagaaaaaataggatttcct
ttgatgatcaaagcctccgaaggcggaggcgggaaaggtatccgcaaggctgagagtgca
gaggacttcccgatgcttttccgacaagtgcagagtgagattccgggctcgccgatcttt
ctaatgaagctggcccagaacgcacggcacctggaggtccaggtcttggcagatcagtat
ggaaacgcggtgtcactgttcggacgggactgttccattcagaggcggcaccagaagatc
attgaggaggctccggccaccatcgccgcgcctgccgtgtttgagttcatggaacagtgt
gctgtcctcctggccaagatggtgggttatgtgagcgcggggactgtggagtacttatac
agccaggatggcagcttccacttcctggagctgaacccacgcctgcaggtggagcatccg
tgcactgaaatgatcgcagatgtcaacctgcctgctgcgcagttgcagatcgccatgggc
gtgcccctgcaccgactgaaggacatacggcttctgtacggagagtccccctggggagtg
acccccattccttttgaaacccccttgagccctcccattgcccgaggccacgtcattgca
gccaggatcaccagcgaaaacccagatgagggctttaagccaagctcggggacagtgcag
gagctgaacttccgcagcaacaagaacgtgtggggttacttcagcgtggccgctgctggg
ggcttgcacgagttcgccgattcccagtttgggcactgcttctcctggggcgagaaccgt
gaagaggccatttcgaacatggtagtggctttgaaggaactgtccatccggggtgacttc
cggaccactgtggagtatctcgttaaccttctggagaccgagagcttccagaacaacgat
atcgacacggggtggctggaccacctcatcgctcagcgggtgcaggcagagaagccggac
atcatgcttggggtggtgtgtggggccttgaatgtggcagacgcgatgttcagaacctgc
atgacggaattcttgcactccctggaaaggggtcaggtcctccctgctgattctctgctg
aacattgtggacgttgaattgatttacggcggcatcaagtatgctctcaaggtagcccga
cagtccctgactatgtttgtcctcatcatgaacggctgccacatcgagatcgatgcccac
cggctgaacgatggggggctgctcctgtcctacaatggcagcagttacactacgtacatg
aaggaagaggttgacagttaccggatcactatcggcaataagacttgcgtgtttgaaaag
gaaaacgaccccactgtcctgagatccccctcggctgggaagctgatgcagtatacggtg
gaggacggagaccacgtggaagctgggagcagctacgcggagatggaggtgatgaagatg
atcatgaccctgaacgtgcaggagagcggccgggtgaagtacatcaagcggccaggggtt
atactggaggctggctgcgtggtggcgaggctagaactcgatgacccttcaaaagtgcac
gcggcccagccgtttactggggagctccctgcccagcagactctgcccatcctcggggag
aagctacaccaagtgttccacggcgtcttggaaaatctgaccaatgtcatgagtggctac
tgcctgcccgagcccttcttcagcatgaagctgaaggactgggtccagaagctcatgatg
acgctccggcatccctccctacctctgctggagctacaggagatcatgaccagtgtggcc
ggccgcatccccgccccggtggagaaggcagtccgcagggtgatggcccagtacgccagt
aacatcacctccgtgctatgccagttccccagccagcagatagccaccatcctggactgc
catgccgccaccctgcagcgtaaggcggaccgagaggtcttcttcatgaacacacagagc
atcgtgcagctggtccagagataccgcagcgggacccgtggctacatgaaggctgtggtg
ctggacctcctgaggaaatatctaaacgtggagcaccattttcagcaagcccactatgac
aagtgtgtgatcaacctgagggagcagttcaagccggacatgacccaggtgctggactgc
atcttctcacactcccaggtggccaagaagaaccagctggtgaccatgctgatagatgag
ctgtgcggcccagaccccaccctgtcagacgagctgacctccatcctctgtgagctcacg
cagctgagcagaagcgagcactgcaaggttgccctcagagccagacaggtcctgatcgcc
tcccacctcccctcctacgagctgcggcacaaccaggtggagtccatcttcctgtccgcc
atcgacatgtacggccaccagttctgcccagaaaatctcaagaaactaatactttcagaa
acgaccatattcgacgtcctgcccactttcttctatcacgagaacaaggttgtctgtatg
gcgtccctggaggtttacgtgcggagaggctacatcgcctacgagctaaacagcctgcag
caccgggagctcccagatggcacctgtgtggtggagttccagttcatgctgccctcttcc
caccccaaccggatggccgtgcccatcagtgtctccaaccccgacctgctgaggcacagc
acagaactcttcatggacagtggcttctccccactgtgccagcggatgggggccatggtg
gccttcaggagatttgaagaattcaccaggaactttgatgaagtcatctcctgctttgcc
aacgtgcagacagacactcttctcttcagtaaggcgtgcacttccctgtactcagaggaa
gacagcaagagcctccgagaggaacccatccacatcctgaatgtggccatccagtgtgcc
gaccacatggaggacgaggcgctggtgccagtcttccgtgcctttgtacagtccaagaag
cacatccttgtggattacggactccgaagaatcacattccttgttgcccaagagagagaa
ttccccaagttcttcacgttcagagcgagggatgagtttgcagaagaccggatttatcgc
cacttggagcctgccctggccttccagctggagctgagccggatgcgcaactttgacctg
accgctgtgccctgtgccaaccacaagatgcatctttacctgggagccgctaaggtgaag
gaagggttggaggtgaccgaccacaggttctttatccgagccattatccggcactcagac
ctgatcaccaaggaagcctccttcgagtacctgcagaacgaaggtgagcggctgctgctg
gaagccatggacgagctggaggtggcgttcaacaacaccagtgtgcgcactgactgcaac
cacatcttcctcaactttgtgcccacagtcatcatggacccgctcaagatcgaggagtcg
gtgcgtgacatggtcatgcgctatggcagccgtctgtggaagctccgagtgctgcaggcc
gaggttaagatcaacatccgtcagacaacctcagatagtgccatccccatccgcctcttc
atcaccaacgagtctggctactacctggacatcagcctctatagagaagtgacggactcc
agatccggaaatatcatgtttcattcctttggcaacaagcaaggtagcctgcatgggatg
ctgatcaatacaccctatgtcaccaaggacctgctccaggctaagcgattccaggcacag
tccctcgggaccacctatgtgtacgacttcccagagatgttcaggcaggctctctttaaa
ctgtggggctccccagagaagtaccccaaagatatcctgacatacacagagctggtgttg
gactctcaaggtcagctggtggagatgaaccggcttcctggttgtaacgaggtgggcatg
gtggccttcaaaatgaggttcaagaccccggagtatccagaaggccgggacgccgttgtc
atcggcaatgacatcaccttccaaatcggctctttcggcataggggaggacttcctgtac
ctgcgagcgtctgagatggcccggacagagggcatcccccaaatctacctggcagctaac
agcggggcccgtatgggcctggctgaggagatcaaacagatattccaagtggcttgggtg
gacccagaggatccccacaaaggatttagatacctgtacctgacgccccaagactacacc
cagatcagttcccagaactcagtgcactgcaagcacatcgaagatgaaggcgaatccaga
tacgtcatcgtggatgtcatcgggaaggatgccaacctgggtgtggagaacctgaggggc
tcgggcatgattgcaggagaagcttccctggcttatgagaaaacggtcaccatcagcatg
gtgacctgccgcgcccttggaatcggggcttacctggtgaggcttggccagcgggtgatc
caggtggaaaactcccacatcatcctcaccggagccggtgctctcaacaaggtcctggga
agagaggtctacacgtccaacaaccagctaggtggcgtgcagatcatgcataccaacggg
gtctcccacgtcaccgtgccagatgacttcgagggggtctgcaccattctggaatggctg
tcatttataccgaaggacaatcgcagcccggtccccatcaccactccttctgaccccatc
gacagggaaattgaattcaccccaaccaaagctccctacgaccccaggtggatgcttgca
ggcaggcctcacccaactctgaaggggacctggcagagtggattcttcgaccatggcagt
ttcaaggaaatcatggcaccctgggcccagactgtggtgacgggacgagcaaggctgggg
ggcatccctgtgggagtgattgctgtggagactcggactgtggaggtggctgtccccgct
gaccctgccaacttggattctgaggccaagatcatccagcaggcgggccaggtgtggttc
ccggactcggcctacaagacggcgcaggtcatcagggacttcaacaaggagcgcctgcct
ctcatgatcttcgccaactggaggggcttctccggaggcatgaaggacatgtatgagcag
atgctgaagtttggcgcctacatcgtggatggtctccgcctgtacgagcagcccattctc
atctacatccctccctgtgcggagctccgtgggggctcctgggttgtcctggactccacc
atcaaccccctgtgcatagagatgtatgcagacaaagagagcagggggggtgttctggag
ccggagggcacggtggagattaagttccggaagaaagatctggtgaaaaccataaggagg
atagacccagtgtgtaagaagctcgtgggacagctggggaaagcccagcttcccgacaag
gaccggaaggagctggagggccagctgaaggcccgggaggaactgctgcttcccatctac
caccaggtggcagtgcagttcgcagacctgcacgacaccccgggccacatgctggagaaa
ggaatcatttctgatgtgctggaatggaagactgcccgcaccttcttctactggaggctg
cgccggctgctgctggaggcccaggtgaagcaggagatactccgagccagccccgagctg
aaccacgagcacacacagtccatgctgcgacgctggttcgtggagactgagggcgctgtc
aaggcctacctgtgggacagcaaccaggtggtggtccagtggctggaacagcactggtca
gccaaggacggcttgcgctccaccatccgtgaaaacatcaattatctgaagcgggactct
gtcctcaagaccatccaaagtctggtccaagaacatccagaggtcatcatggactgcgtg
gcctacctgagccagcacctcacgccagccgagcggatacaggtggctcagctgctgtct
accacggagagcccagcttcctcctga

DBGET integrated database retrieval system