KEGG   Mus musculus (mouse): 100727Help
Entry
100727            CDS       T01002                                 

Gene name
Ugt2b34, AI788959
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B34
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00140  Steroid hormone biosynthesis
mmu00830  Retinol metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100727 (Ugt2b34)
   00053 Ascorbate and aldarate metabolism
    100727 (Ugt2b34)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100727 (Ugt2b34)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100727 (Ugt2b34)
   00860 Porphyrin and chlorophyll metabolism
    100727 (Ugt2b34)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100727 (Ugt2b34)
   00982 Drug metabolism - cytochrome P450
    100727 (Ugt2b34)
   00983 Drug metabolism - other enzymes
    100727 (Ugt2b34)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100727 (Ugt2b34)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100727 (Ugt2b34)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   100727 (Ugt2b34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 100727
NCBI-ProteinID: NP_705826
MGI: 2140962
Ensembl: ENSMUSG00000029260
Vega: OTTMUSG00000022931
UniProt: Q8K154
Position
5; 5 E1
AA seq 532 aa AA seqDB search
MPVKMTAALLLLLLQLSGFFGSGTGGKVLVWPMEFSHWLNLKTILDELLKKGHEVMVLRP
SASLSYEVDNTSAIEFETYPTSYSLSELEEIFWESLKKYIYELPKQSFWGYFLMLQEMVW
VDSKYFESLCKDVVFNKELMTKLQKSRFDVILADPFIPCGDLLAEVLKIPLVYSLRFFPG
STYEKYSGGLPLPPSYVPVVMSELSDRMTFMERVRNVIYMLCFDFWFQTFNEKNWNQLYT
EVLGRPTTLSETMAKADIWLIRTYWDLEFPHPVLPNFDFIGGLHCRPAKPLPKEIEDFVQ
SSGEHGVVVFSLGSMVGSITEERANVIAAGLAQIPQKVLWRFEGKKPETLGSNTRLYKWI
PQNDLLGHSKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKAKGAAVRLDF
LTMSSTDLHTALKTVTNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLR
VAAHDLSWVQYHSLDVLGFLLACVLTVMFILKKCCLFCCQKLTKAGRKKKGE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaaaatgacagcagccctgctcctgctcctgctccagctgagtggcttcttt
ggatctgggactggtgggaaggtgctggtgtggccaatggagttcagccattggctcaac
ttgaagacaatcctagacgagcttctgaagaagggtcatgaagtgatggttctgagacct
tcagcatccttatcttatgaggttgacaacacatctgctattgaattcgagacttatcct
acatcatactccttatctgagttagaggaaattttctgggaatcactcaagaaatatatt
tatgagctgccaaagcagtcattttggggatacttcttaatgttgcaagaaatggtttgg
gtagattcaaaatattttgaaagtctctgtaaagatgtagtttttaacaaagaactcatg
acaaagctacaaaaatcaaggtttgatgtgatcctggcagatcccttcataccctgcggt
gatctgctggctgaggttctcaagatcccccttgtgtacagtctccgcttctttcctggc
tccacttatgagaagtacagtgggggactcccactgcctccttcctatgtgcctgttgtt
atgtcagaattgagtgacaggatgactttcatggagagggtgagaaatgtcatctatatg
ctgtgttttgacttttggttccaaacatttaatgagaagaactggaatcagctttatact
gaagtattaggaagacccacgacactctcagagactatggccaaagcagacatatggctc
attaggacctactgggatttagaatttcctcatcctgtcttaccaaattttgattttatt
ggtggcctccactgcagacctgccaagcccctgcctaaggaaatagaagactttgtccag
tcatctggagaacatggtgttgtggtgttttccctggggtccatggtgggtagcataaca
gaagaaagagccaatgtgattgcagcaggccttgctcagattccacagaaggttctgtgg
agatttgagggcaagaagccagagacattgggctccaacactcgtctgtacaaatggatc
ccccagaatgaccttctaggtcattccaaaaccagagcgtttataactcatggtggcacc
aatggcatctatgaggcgatctaccatgggattccagtggttggcattcctttgtttgga
gaccaatatgacaatattgtgcacttgaaggccaaaggagcagctgttagactggacttt
ctcacaatgtctagtacagatttgcacactgcactgaagacagtcactaatgacccttcc
tataaggagaatgccatgcggttatcaagaattcaccatgatcagccagtgaagcccctg
gaccgagcagtcttctggattgagtttgtcatgcgtcacaaaggagccaagcatcttcgt
gtggcagcccatgacctcagctgggtccaataccactctctggatgtgcttgggttcctg
ctggcctgtgtgctgactgtgatgttcatcctcaaaaagtgttgcctcttttgttgccag
aagttgactaaagctggaaggaagaagaaaggggagtag

DBGET integrated database retrieval system