KEGG   Mus musculus (mouse): 100756Help
Entry
100756            CDS       T01002                                 

Gene name
Usp30, 6330590F17Rik, AI851327, D5Ertd483e
Definition
ubiquitin specific peptidase 30 (EC:3.4.19.12)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100756 (Usp30)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100756 (Usp30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5 55.96 cM
AA seq 517 aa AA seqDB search
MLSSRAQAARTAADKALQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFVKWLEEFTTQYSRDQQGPHTHQCLSLTL
LNLLKALSCQEVTEDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQSEMAPRQVTCHTRGSPHPTTNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEARGTLTGEK
VEHQRSTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDFYKYRLLG
HKPSQHGPKATENPGSAPEVQDAQAAPKPGLSQPGAPKTQIFLNGACSPSLLPALPSPVA
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSRVQQQGREYRSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctaagttcccgggcgcaggcggcgaggacggcggccgacaaggccctgcagcgcttc
ctgcgcaccggggcggccgtcagatacaaagtcatgaagaactggggagtgatcggtggg
attgccgctgccctggcagcagggatctatgttatttggggtcccattacagagaggaag
aagcggagaaaagggcttgtgcctggccttgtcaatctggggaatacctgcttcatgaac
tcgctgctgcagggcctgtctgcctgccctgcgtttgtcaagtggctggaagagtttacc
acccagtactccagggaccagcaggggccacacactcaccagtgcctgtccttaacactg
ctgaacctcctgaaagctctgtcctgccaagaagtcaccgaggacgaggtcttggacgcc
agctgtctgctggacgtcctgagaatgtacagatggcagatctcgtcctttgaggagcag
gatgctcacgagctgtttcatgtcatcacctcatcactggaggacgagagagaccgccag
cctcgagtcacccacttgtttgatgtgcattccctggagcagcagtcagaaatggctccc
agacaagtcacttgccacacgagagggtcccctcaccccacgaccaatcactggaagtct
cagcaccctttccatggaagactcaccagtaacatggtgtgcaaacactgtgaacaccag
agtcctgttcggtttgacacctttgacagcctttctctcagtattccagctgccacttgg
gggcacccactgacactggaccactgccttcaccacttcatctcatcagagtccgtgcga
gacgttgtgtgtgacaactgtacaaagattgaagcgagggggacactgaccggggagaag
gtggagcatcagaggagcacctttgttaaacagttaaaactcggaaagctgccacagtgc
ctctgcatccacctgcagcggctcagctggtccagccacggcacgcccttgaagcggcac
gagcacgtgcagtttaacgagttcctgatgatggacttctacaagtaccgcctcctggga
cacaagcccagccagcatggccccaaagccaccgagaacccagggtctgccccagaagta
caggacgcacaggcggccccaaagccaggtctgagtcagccaggggcccccaagacacag
atttttctgaatggcgcctgctccccgtctctgttgccagccctgccttccccggtggcc
ttccctctgccagtggttcctgactacagctcctccacatacctcttccgcttgatggca
gttgtcgttcaccatggagacatgcactctggacactttgtcacctacagacggtcacca
ccttctgccaagaaccctctctcaaccagcaaccaatggctgtggatttctgacgacacc
gtccgcaaggccagcctgcaggaggtcctgtcctctagtgcctacctgctgttctatgag
cgagttctgtccagggtgcagcagcaggggcgagagtataggtctgaggagtga

DBGET integrated database retrieval system