KEGG   Mus musculus (mouse): 101320Help
Entry
101320            CDS       T01002                                 

Gene name
Dyrk4, AW049118, Dyrk4a, Dyrk4b
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F3; 6
AA seq 632 aa AA seqDB search
MQLLRLPALTRTETSMDTNKARKRSLTTFPILKARKKQSFTSVKVESKPLGHLQKPSSKN
KKLRVNRCPQKIPSNTAFPFVDTKGKRNTVNFPQIGNKVPSKGPMQYQENQIHNQVLSSE
LKTSEIPFNINTKAQDTKPHPELQKKHKVPLTVAEALKFFKNQLSPYEQSEILGYSELWF
LGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHK
NNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFEL
LGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVT
VKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFP
GENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPKNINNNRGGKRYPDSKDLTMV
VKTYDSSFLDFLRRCLVWEPSLRMTPEQALKHAWIHEPRKFKPRPKPQILRKPGASISSE
ISTEKAEEQQASKGKKDEATKETTDKLKDEAEKHLENSGKQQSSVEHTADTIQLPHLTEA
SGKSETVAGSEMSAEQQSTSSPKSTNILPPIV
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcctccgacttcctgccctcacccggacagagacttcaatggatacaaacaag
gcaaggaaacgcagtttgacaaccttcccaattttgaaagcaaggaagaagcagagtttc
acctctgtgaaggttgagagtaagcctttgggtcacctccagaagccatcctccaagaac
aagaagctgagagtgaaccgatgtccacaaaagattccaagtaacacggcgttccctttt
gtggacacaaaggggaagaggaacacagttaacttcccccagattggcaacaaagtccca
tcaaaggggcccatgcagtatcaggaaaatcaaattcataatcaagtgctatcctctgaa
ctcaagacttcagaaatacctttcaacattaacaccaaagcccaagacaccaagccacac
ccagaactacaaaagaagcacaaagtccctcttacagtagcagaggccctaaagttcttt
aagaatcagctgtccccttatgagcaaagcgaaatcctgggctactcagagctgtggttc
ctgggccttgaagccaagaagctcaacgtggttccagagaagttcagcaagacaagcttt
gatgatgagcacggttcctatatgaaggtcctgcatgaccacattgcctaccgatatgag
gttctggagatgatcgggaaagggtcctttggacaggtggccaagtgcttggatcacaaa
aacaatgagttggtggccctgaaaatcatcaggaacaaaaagagatttcaccatcaggct
ctggtggagctgaagatcctggaagccctcagaaggaaggacaaagacaacaaccacaat
gtggtccacatgaaggatttcttctacttccggaatcacctctgtatcacctttgagctc
ctgggaatcaacctgtatgagttgatgaagaacaacagctttcatggcttcaatctgtcc
atagttcggcgcttcaccttttccattttgaaatgcttacacatgctttatgtagagaaa
atcatccactgtgacctcaagccggaaaatattgtgctataccagaggggccaagtcact
gttaaagttattgactttgggtcaagctgttatgaacaccagaaagtgtatacgtacatc
caaagtcgtttctaccgatccccagaggtgattctgggacacccctataacatggccatt
gacatgtggagcctgggctgcatcatggcggagctgtacaccggatacccactgttccct
ggggagaacgaggtggagcagctggcttgcatcatggaggtgctgggcctgccacctgcc
cacttcacccagacagcctccaggagacaggtattctttgattccaaaggtcttcccaaa
aatataaacaacaacagagggggaaaaagatacccagattccaaggatctcacgatggtg
gtgaaaacctacgattccagcttcctggactttctcagaaggtgtttggtgtgggagcct
tctctgcgcatgacccccgagcaggccctcaagcatgcctggattcacgagccgaggaaa
ttcaaaccacggcccaagccacagatattaaggaagcctggtgccagtatttcctctgag
ataagcacggaaaaggctgaagagcaacaggccagcaaaggcaaaaaagatgaggctacc
aaagaaactacagacaaattgaaggacgaagctgagaagcaccttgagaattcgggcaaa
cagcagagctctgtggagcacacagcagacaccatccagctgcctcacctaacagaagct
tctggaaagtcagagactgttgctgggtcagagatgtccgcagaacagcagagcacctcc
tcccccaagagcacaaacatcttaccacccatcgtgtga

DBGET integrated database retrieval system