KEGG   Mus musculus (mouse): 101540Help
Entry
101540            CDS       T01002                                 

Gene name
Prkd2, AI325941, PKD2
Definition
(RefSeq) protein kinase D2 (EC:2.7.11.13)
  KO
K06070  
protein kinase D [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101540 (Prkd2)
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    101540 (Prkd2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101540 (Prkd2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  PKD family
   101540 (Prkd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A2
AA seq 875 aa AA seqDB search
MAAAPSHPAGLPGSPGPGSPPPPGGLDLQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAADIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGSSESLPCTAEELSRSTTDLLPRRPPSSSSS
SSSSSFYTGRPIELDKMLMSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCK
FNCHKRCATRVPNDCLGEALINGDVPMEEAADYSEADKSSISDELEDSGVIPGSHSESAL
HASEEEEGEGHKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYW
RLDCKCITLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIITANVTYFVG
ETPGGAPGGPSGQGTEAVRGWETAIRQALMPVILQDAPSAPGHTPHRQASLSISVSNSQI
QENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEV
AILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQIL
VALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLA
PEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISSG
AIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWDQ
FVAERHGTPAEGDLGGACLPQDHEMQGLAERISIL
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccccctcccatcccgcaggactccccggctctccggggcccgggtctcct
ccgccccccggtggcttggatctccagtcgccgccacctctgctgcctcagatcccggct
ccgggttcgggggtctccttccatatccagatcggattgacccgagagttcgtgctgttg
ccggctgcctcagagttggctcatgtgaagcaactagcctgttctatcgtggaccagaag
ttcccagagtgtggcttctacggcctgtacgacaagatcctgctcttcaaacatgaccca
acatcagccaacctcctgcagctggtgcgatcagctgcagatatccaggagggtgacctg
gtggaggtggttctgtcggcctcggccaccttcgaggatttccagatccgaccgcatgct
ctcactgtgcactcgtaccgcgctcccgccttctgtgaccactgcggggagatgctcttc
ggcctcgtgcgccagggcctcaagtgcgatggctgcgggctgaattaccacaaacgctgc
gccttcagcatcccgaacaactgcagtggtgctcgaaagcgccgcctgtcatccacgtct
ctggccagtggccattctgtgcgccttggcagctccgagtccttaccctgcaccgccgaa
gagctgagccgtagcaccaccgacctccttcctcgccgaccaccctcgtcgtcgtcctcc
tcctcttcctcttccttctacacaggccgacccattgagttggacaagatgctgatgtcc
aaggtcaaggtgccacacaccttccttatacatagctacacacggcccaccgtttgccag
gcttgcaagaaactgctcaagggtctattccgccagggcctgcagtgcaaagactgcaag
tttaactgtcacaaacgctgtgctacccgcgtccctaacgactgcctgggggaggcgctc
atcaatggagacgtgccgatggaggaagccgctgattacagtgaggctgataagagctcc
atctcagatgagttggaggattctggtgtcatccccggctcccactcagagagtgctctc
catgccagtgaggaagaggaaggcgagggacacaaggcccagagctcgctgggatacatc
cccctgatgcgcgtggtacagtctgtgcgacacacgacccggaaatccagcaccaccctg
cgggagggctgggtggtccattacagcaacaaggacacactgaggaaacggcactactgg
cgtctagactgtaaatgcattaccctcttccagaacaacacgaccaacagatactacaag
gaaatcccgctgtctgaaatccttgcggtggaaccggctcagaacttcagcctcgtaccc
ccgggcaccaacccacactgcttcgagatcatcacggccaatgtcacctactttgtgggc
gaaacccctggcggggccccgggagggccaagtggacagggaacagaggccgttcggggt
tgggagacagccatccgccaggcactgatgcccgttatcctccaagatgcgcccagtgcc
ccggggcacacaccgcacagacaagcgtctctgagtatctccgtgtccaacagtcagatc
caagagaatgtggatatcgccactgtctaccagatcttcccagatgaggtgctgggctct
gggcagtttggagtggtttatggaggaaaacacaggaagactggcagagacgttgcagta
aaggtcattgacaaactgcgcttccccaccaagcaggagagccagctcaggaatgaagtg
gccattctccagagtctacggcaccccgggattgtgaacctcgagtgcatgtttgagact
cctgagaaggtattcgtggtgatggagaaactgcacggggacatgttggagatgatcctc
tccagtgagaagggccggcttcctgagcgtctcaccaagttccttatcacgcagatcctg
gtggcgctgagacacctgcacttcaagaacatcgtccactgtgacttgaaaccagagaat
gtgttactggcatcagccgatccgtttcctcaggtgaagctctgtgactttggcttcgct
cgcatcatcggcgagaagtccttccggcgctcagtggtgggcacgcctgcctacctggca
cccgaggtactgctcaaccagggttacaaccgctcgctggacatgtggtccgtgggtgtg
atcatgtacgtgagccttagtggcacgttccccttcaatgaggacgaggacatcaatgac
cagatacagaacgcggcctttatgtacccggccagcccctggagccacatctcatctgga
gccatcgacctcatcaacaacctgttgcaggtgaagatgcgcaagcgctacagcgtggac
aagtctctcagccacccatggttacaggagtaccagacgtggcttgacctccgagagcta
gagggaaagatgggcgagcgatatatcacgcacgagagcgacgacgcacgctgggatcag
tttgtggcagagcgccatgggactcctgcagaaggggacctgggtggcgcctgtctgccg
caggaccacgagatgcaggggctggctgagcgcatcagcatcctctga

DBGET integrated database retrieval system