KEGG   Mus musculus (mouse): 101568Help
Entry
101568            CDS       T01002                                 

Gene name
Vrk3, AI428238
Definition
(RefSeq) vaccinia related kinase 3 (EC:2.7.11.1)
  KO
K08816  
vaccinia related kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101568 (Vrk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CK1 group
  VRK family
   101568 (Vrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B4
AA seq 453 aa AA seqDB search
MISFCPVCGKSVKVSFKFCPYCGKALPVEEDGGTQSAVTPHVSSVPGSRRDLNSSFETSP
KKVKCSHTVTSLPLSRHSDCDSSGSDNTLTSPDRATGTRSRPLTPKGSPLSNRQSPQTLK
RTRVTTSLQALATGTELTDQNGKHWTLGALQIRDDQGILYEAEPTSAVPSESRTQKWRFS
LKLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPS
LGRSLQSALDDNPKHVVSERCVLQVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLSQ
VTLVGYGFTYRYCPGGKHVAYKEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCML
KWLYGSLPWTNCLPNTEKITRQKQKYLDSPERLVGLCGRWNKASETLREYLKVVMALNYE
EKPPYATLRNSLEALLQDMRVSPYDPLDLQMVP
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatctccttctgtccagtctgtggcaaaagtgtcaaggtatcattcaagttctgccct
tactgtggcaaggccctgcctgtagaggaggatggaggcacccagtctgccgtgacgcct
catgtgtcatccgttccaggctccaggagagacctgaactccagttttgaaacctctccc
aagaaagtgaaatgctcacacactgtcacttctctcccactctcccgccactctgactgt
gacagttctgggtcagacaacaccttgacttctcctgacagggccacaggcacccggagc
agacccctgacccccaaaggcagcccactttccaacaggcagagccctcagactctgaag
cggacccgggtgaccacctcactccaggctctagccacaggaacagagctgacagaccag
aatgggaaacactggaccctgggggccctgcagatccgggatgaccaaggcattctctat
gaagctgagcctacttctgccgtcccctctgaatcaaggacccagaagtggagattctca
ctcaaactggactccaaggatgggcgccttttcaatgagcagaacttctttcagagagta
gccaagcctctgcaagtgaacaaatggaagaagcagttcttgctcccgctcctggccatc
cccacctgtatcggctttggcattcaccaggacaagtacaggttcctagtattccccagc
ctggggaggagccttcagtcagccctggatgacaacccaaagcatgtggtatcagagaga
tgtgtgcttcaggtggcctgcaggctgctggatgctctggagtatctccatgaaaatgag
tatgttcacgggaacctgacagctgagaatgtctttgtgaatccagaggatctgagccag
gtgaccctggtgggctatggcttcacctaccgatactgcccaggtggcaaacacgtggcc
tacaaagaaggcagcaggagtccacacgatggggacttggagttcattagcatggacctg
cacaagggatgcggaccctcccgccgcagcgatctccagaccttgggctactgtatgctc
aagtggctttatgggtccctgccatggacaaattgccttcccaacaccgaaaagataact
aggcagaagcagaagtatctggacagccccgagcgcctcgtgggactgtgtggccgctgg
aacaaggcctcagagaccctgcgggagtacctgaaggtggtgatggccctcaattatgag
gagaagccaccctatgccacgctgaggaacagcctagaagctctgctgcaggatatgcgg
gtgtcaccctatgaccctctggacctccagatggtgccttag

DBGET integrated database retrieval system