KEGG   Mus musculus (mouse): 102022Help
Entry
102022            CDS       T01002                                 

Gene name
Ces2a, 9130231C15Rik, AI266984, Ces6
Definition
carboxylesterase 2A (EC:3.1.1.88)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mmu00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 D3; 8
AA seq 525 aa AA seqDB search
MPLARLPGWLCVVACGLLLLLQHVHGQDSASPIRNTHRGQVRGSFVHVKDTKSGVHAFLG
IPFAKPPVGLLRFAPPEDPEPWSGVRDGTSQPAMCLQPDIMNLEDAKEMNLILPPISMSE
DCLYLNIYTPTHAQEGSNLPVMVWIHGGGLVVGSASMNDVSKLAATEEIVIVAIQYRLGV
LGFFSTGDQHARGNWGYLDQVAALRWVQKNIAYFGGNRDRVTIFGVSAGGTSVSSHILSP
MSKGLFHGAIMQSGVALLPDLISDTSEVVYKVFKMIPAVVDGEFLPKHPQELLTSMDFHP
VPSIIGVNTDECGWGVPMFMGLDHIIKNITRETLPAVLKNTAARMMLPPECSHLLVEEYM
GDTEDPETLQAQFREMLGDFMFVIPALQVAHFQRSQAPVYFYEFQHLSSFIKHVRPSHVK
ADHGDDVAFVFGSYLWDMNLDLTEEEELLKRMMMKYWANFARNGNPNSEGLPSWPVLDHD
EQYLQLDTQPAVGRALKARRLQFWTKTLPQKIQELKGSQDKHAEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgccattggctagacttcctggttggctgtgtgttgttgcctgtgggctcctgcttctc
ctccagcatgtgcatggccaggactcagccagccccatcaggaacacccacaggggtcag
gtgagaggcagctttgtccacgtgaaggacactaaatctggtgtccatgccttcctggga
atcccctttgccaagcctcctgtaggactactgcgctttgcacctcctgaggaccctgag
ccatggagtggtgtgagagatgggacctcacagccggccatgtgtctgcagcctgatata
atgaatttagaggatgcgaaggaaatgaatctgatcctgcctcccatctctatgtccgag
gactgcctgtatctcaacatctacacaccaacccacgcccaggagggctctaacctgcct
gtgatggtatggatccacggtggtggactggttgtaggatcagcttccatgaatgatgta
tctaaactggcagccactgaggaaatagtaattgtcgccatccagtatcgcttgggggtc
cttggcttcttcagcactggagaccagcatgccagaggcaactggggatacctggaccaa
gtggctgccttacgctgggtgcagaagaatattgcttactttggaggcaaccgtgacagg
gtcactatatttggagtctcagcaggaggtacaagtgtgtcttctcatattctgtcccca
atgtccaaaggactctttcatggagccattatgcagagtggagtggccctgctgcctgac
ctcatctctgacacttctgaggtggtctacaaggtcttcaagatgatccctgctgtggtg
gatggggagttcctacccaagcatcctcaggagctgctgacctctatggattttcaccct
gtccccagcatcattggtgtcaacacagatgaatgtggctggggagtccccatgttcatg
ggccttgaccatatcataaagaacataaccagagagaccctgccagctgttctgaagaac
acagcagcacggatgatgttgcctccagaatgtagtcacctgctagtggaggagtatatg
ggggacactgaggacccagagaccctgcaagcacagttcagagagatgctgggggacttc
atgtttgtgatccctgctctccaagtggcacatttccagcgttcccaggctcctgtctac
ttctatgagttccagcatctgtccagcttcatcaagcatgtcaggccatcacatgtgaag
gcagaccatggtgatgacgttgcctttgtctttggctcctatttgtgggacatgaatttg
gacctcactgaggaggaggagctgctaaagaggatgatgatgaagtactgggccaatttc
gcaagaaatgggaaccccaacagtgagggtctaccctcctggcctgtgttggaccatgat
gagcagtacctgcagctggacacccagcctgctgtgggtcgagccctgaaggccagaagg
ctgcagttctggaccaagactctgccccagaagatccaggagctcaagggttctcaggac
aagcatgcagagctgtag

DBGET integrated database retrieval system