KEGG   Mus musculus (mouse): 102247Help
Entry
102247            CDS       T01002                                 

Gene name
Gpat4, AU041707, AW545732, Agpat6, Tsarg7
Definition
(RefSeq) glycerol-3-phosphate acyltransferase 4 (EC:2.3.1.15)
  KO
K13506  
glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102247 (Gpat4)
   00564 Glycerophospholipid metabolism
    102247 (Gpat4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     102247 (Gpat4)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  GPAT
   102247 (Gpat4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8; 8 A2
AA seq 456 aa AA seqDB search
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKTLLKIFAWATLR
MERGAKERNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDKTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRI
ALAFTGIGLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREKDEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgttgctaccttttgatagcttgattgtcaacctcctgggtatctccctgacc
gtcctcttcaccctgctgcttgttttcatcatcgtccctgccatctttggagtgtccttt
ggtatccgaaagctctacatgaaaacactgctaaagatctttgcgtgggccaccctgaga
atggagagaggagccaaggagaggaaccaccagctgtacaagccctacaccaacggaatc
attgcaaaagatcccacttctctggaagaagaaatcaaagaaattcgtcgaagtggtagt
agtaaagctctggataagacacccgagttcgagctctctgacatcttctacttttgccgg
aaaggaatggagactatcatggatgatgaagtgacaaagagattctcggcagaggagctg
gagtcctggaacttgctgagcagaaccaattacaacttccaatacataagcctgcggctt
accatcctctggggcttaggagtgctgattcggtattgcttcctcctgccactcaggatt
gcgctggcattcacggggattggcctcttggtagtgggaactactatggttggatacctg
ccaaatgggagatttaaggagtttttgagtaaacacgttcacttaatgtgctaccgtatc
tgtgtgcgagccctgacggccatcattacgtaccacaacaggaaaaacagaccaagaaat
ggtggcatctgtgtggctaaccatacatcccccattgatgtgatcatcttggccagcgac
ggctactacgccatggtgggacaggttcacgggggccttatgggtgtgattcagagagca
atggtgaaagcctgcccccatgtctggtttgagcgttctgaggtgaaagatcgccacctg
gtggctaagaggctgactgagcatgtccaggataaaagcaagctgcccatcctcatcttc
ccagaaggaacctgcatcaataacacatcagtgatgatgttcaagaagggaagctttgaa
attggagccactgtttaccctgtggctatcaagtatgaccctcagtttggtgacgccttc
tggaacagcagcaagtatggcatggtgacgtaccttctgaggatgatgaccagttgggcc
attgtctgcagcgtttggtacctgcctcctatgactcgagagaaagatgaagatgctgtg
cagtttgctaacagagtgaagtctgccattgcccggcagggaggattggtagacctgctg
tgggacggtggattgaagagagaaaaggtgaaggacacattcaaggaggagcagcagaag
ctatatagcaagatgatagtcggaaaccatgaggaccgcagccggtcctga

DBGET integrated database retrieval system