KEGG   Mus musculus (mouse): 102414Help
Entry
102414            CDS       T01002                                 

Gene name
Clk3, AI256811
Definition
(RefSeq) CDC-like kinase 3
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     102414 (Clk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CLK family
   102414 (Clk3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    102414 (Clk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 102414
NCBI-ProteinID: NP_031739
MGI: 1098670
Ensembl: ENSMUSG00000032316
Vega: OTTMUSG00000063206
UniProt: O35492
Position
9; 9 B
AA seq 638 aa AA seqDB search
MPVLSARRKRLASTAGPRRGSGPSLAVRWVPPLGPEPSSDRGRAPMRPRGPTCSTTRRGA
GRGPRLLPGPPGRDLHRCRPDPGGAGQSPRVCEFGARAVRPLGRVEPGPPTAASREGAVL
PRAEARAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
RLRYPSRREPPPRRSRSRSHDRIPYQRRYREHRDSDTYRCEERSPSFGEDCYGSSRSRHR
RRSRERAPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
LEFDPAQRITLAEALLHPFFAGLTPEERSFHSSRNPSR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcctctccgcgcgcaggaagaggctggcgagcacagctgggccgcggcgggga
agcggccccagcctggcagtccggtgggttcctcctttaggcccagagccgtcctcagac
cgtggtcgcgcaccgatgcggcctcgggggcctacgtgcagcaccacacggagaggggca
ggccgcggcccgaggctgctcccgggacctccgggaagagacctccaccgatgtcgcccg
gaccctggcggggcaggccagtcccccagagtctgcgagttcggggctagagcggtcagg
cctctgggccgggtcgagcccgggccgccgacggctgcgtcacgcgagggggcggtgctg
ccacgggcggaggccagagccggaagcggaagaggcgctcggagtggggagtggggccta
gccgcagccggagcctgggagacgatgcatcactgtaagcgataccgttccccagagcca
gacccatacctgagctaccgctggaagaggaggcggtcttacagtcgggagcatgaaggt
cgactacgatacccatcccgaagggagcctcccccacggagatcacggtccagaagccat
gatcgtataccctaccagcggaggtaccgggaacaccgtgacagtgatacgtatcggtgt
gaagagcggagcccatcttttggagaggactgctatgggtcttcacgttctcgacatcgg
agacggtcacgagagagggcgccgtaccgtacccgcaagcatgcccaccactgtcacaaa
cgccgtaccaggtcttgtagcagtgcttcctcgagaagccaacagagcagtaagcgcagc
agccggagtgtggaagatgacaaggagggccacctggtgtgccggatcggcgattggctc
caagagcgatatgagatcgtggggaacctgggtgaaggcacctttggcaaggtggtggag
tgcttggaccatgccagagggaagtcacaggttgccctgaagatcatccgtaatgtgggc
aagtatcgggaagctgctcgtctagaaattaatgttctcaagaaaatcaaggagaaagac
aaggaaaataagttcctttgtgtcctgatgtctgactggttcaacttccatggtcatatg
tgcatcgcctttgagctcctgggcaagaacacctttgagttcctgaaggagaacaacttc
cagccttaccccctaccacatgtccggcacatggcctaccagctctgtcatgcccttaga
tttctacacgagaaccagctgacccacacagacttgaagccagagaacatcttgtttgtg
aattctgagtttgaaaccctctacaatgagcacaagagctgcgaggagaagtcagtgaag
aacaccagcatccgagtggcagactttggcagtgccacgtttgaccatgaacatcacacc
accattgtggccacccgtcactaccgcccacctgaggtgatccttgagctgggctgggca
cagccctgtgatgtctggagtatcggctgcattctctttgagtactaccgtggctttaca
ctcttccagacccatgaaaatagagaacacttggttatgatggagaagattctaggaccc
atcccatcacacatgatccaccgtaccaggaagcagaaatatttctacaaagggggcctg
gtttgggatgagaacagctctgatgggcggtatgtgaaggagaactgcaaacctctgaag
agttacatgctgcaggactccctggagcatgtgcagctgtttgacctgatgaggaggatg
ttagagttcgaccctgctcagcgcatcacattggcagaagccttgctgcaccccttcttt
gctggcctgacccctgaggagcggtccttccacagcagccgtaaccccagcagatga

DBGET integrated database retrieval system