KEGG   Mus musculus (mouse): 103140Help
Entry
103140            CDS       T01002                                 

Gene name
Gstt3, AI118089
Definition
glutathione S-transferase, theta 3
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mmu00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mmu00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mmu00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10
AA seq 241 aa AA seqDB search
MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG
DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF
PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHISVADLVAITELMHPVSA
GCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPPLMDPALKEKLKLSVQCLL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagctctacctggacctgatgtcccaaccctgccgtgctgtctacatcttc
gccaagaagaacggcatccccttccagctgcgtaccatagagctgcttaaaggtcagcag
tacacagattccttcgcccaggtgaaccctttgaggaaggtgccagctttgaaggatggg
gacttcgtcttggcagagagtgtggccatcttgttgtatctgagtagaaagtacaaggcc
cccgaccactggtaccctcaggatctgcagactcgagctcgtgtagacgagtacctggca
tggcagcacacagccctgcggagttgttgcaccagggccatgtggcagaagatgatgttc
cctgtgttcctgggacagcccgtacctcctgagatgctggcatccaccttggctgaactg
gatgggtgcctgcaggtgctagaggacaagttcctgcggaaccaggccttccttacagga
tcccatatttctgtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgcaaaatctttgagagccgacccaaactggctgcctggcgtcagagagtagaagcc
gaagtgggggagagcctcttccaggaggcccatgaagttgtcctgaaggccaaggatatg
cctcccttgatggaccctgccttgaaagagaagctgaagctctctgtgcagtgtttgtta
cactga

DBGET integrated database retrieval system