KEGG   Mus musculus (mouse): 103140Help
Entry
103140            CDS       T01002                                 

Gene name
Gstt3, AI118089
Definition
glutathione S-transferase, theta 3
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103140 (Gstt3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103140 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    103140 (Gstt3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    103140 (Gstt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103140 (Gstt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10
AA seq 241 aa AA seqDB search
MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG
DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF
PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHISVADLVAITELMHPVSA
GCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPPLMDPALKEKLKLSVQCLL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagctctacctggacctgatgtcccaaccctgccgtgctgtctacatcttc
gccaagaagaacggcatccccttccagctgcgtaccatagagctgcttaaaggtcagcag
tacacagattccttcgcccaggtgaaccctttgaggaaggtgccagctttgaaggatggg
gacttcgtcttggcagagagtgtggccatcttgttgtatctgagtagaaagtacaaggcc
cccgaccactggtaccctcaggatctgcagactcgagctcgtgtagacgagtacctggca
tggcagcacacagccctgcggagttgttgcaccagggccatgtggcagaagatgatgttc
cctgtgttcctgggacagcccgtacctcctgagatgctggcatccaccttggctgaactg
gatgggtgcctgcaggtgctagaggacaagttcctgcggaaccaggccttccttacagga
tcccatatttctgtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgcaaaatctttgagagccgacccaaactggctgcctggcgtcagagagtagaagcc
gaagtgggggagagcctcttccaggaggcccatgaagttgtcctgaaggccaaggatatg
cctcccttgatggaccctgccttgaaagagaagctgaagctctctgtgcagtgtttgtta
cactga

DBGET integrated database retrieval system