KEGG   Mus musculus (mouse): 103140Help
Entry
103140            CDS       T01002                                 

Gene name
Gstt3, AI118089
Definition
(RefSeq) glutathione S-transferase, theta 3
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103140 (Gstt3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103140 (Gstt3)
   00982 Drug metabolism - cytochrome P450
    103140 (Gstt3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    103140 (Gstt3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103140 (Gstt3)
  Drug resistance
   01524 Platinum drug resistance
    103140 (Gstt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103140 (Gstt3)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   103140 (Gstt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10; 10 C1
AA seq 241 aa AA seqDB search
MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDG
DFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMF
PVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHISVADLVAITELMHPVSA
GCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPPLMDPALKEKLKLSVQCLL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagctctacctggacctgatgtcccaaccctgccgtgctgtctacatcttc
gccaagaagaacggcatccccttccagctgcgtaccatagagctgcttaaaggtcagcag
tacacagattccttcgcccaggtgaaccctttgaggaaggtgccagctttgaaggatggg
gacttcgtcttggcagagagtgtggccatcttgttgtatctgagtagaaagtacaaggcc
cccgaccactggtaccctcaggatctgcagactcgagctcgtgtagacgagtacctggca
tggcagcacacagccctgcggagttgttgcaccagggccatgtggcagaagatgatgttc
cctgtgttcctgggacagcccgtacctcctgagatgctggcatccaccttggctgaactg
gatgggtgcctgcaggtgctagaggacaagttcctgcggaaccaggccttccttacagga
tcccatatttctgtggctgacttggtggccatcacagagctgatgcatcctgtcagtgct
ggctgcaaaatctttgagagccgacccaaactggctgcctggcgtcagagagtagaagcc
gaagtgggggagagcctcttccaggaggcccatgaagttgtcctgaaggccaaggatatg
cctcccttgatggaccctgccttgaaagagaagctgaagctctctgtgcagtgtttgtta
cactga

DBGET integrated database retrieval system