KEGG   Mus musculus (mouse): 103963Help
Entry
103963            CDS       T01002                                 

Gene name
Rpn1, AU018702, D6Wsu137e, Rpn-1
Definition
(RefSeq) ribophorin I (EC:2.4.99.18)
  KO
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
mmu  Mus musculus (mouse)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103963 (Rpn1)
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103963 (Rpn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 D1; 6 39.13 cM
AA seq 608 aa AA seqDB search
MESPVALLLLLLLCLGALAPTPGSASSEAPPLVNEDVKRTVDLSSHLAKVTAEVVLVHPG
GGSTSRASSFVLALEPELESRLAHLGVQIKGEDEEDNNLEVRETKIKGKSGRFFTVKLPV
ALDPGSKISVVVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLAS
RNVESYTKLGNPSRSEDVLDYGPFKDIPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHW
GNIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGN
VSTSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHV
FDEQVIDSLTVKIILPEGAKNIQVDSPYDISRAPDELHYTYLDTFGRPVIVAYKKNLVEQ
HIQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACIT
EQVLTLVNKRLGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKAVTSEIAVLQSRLKT
EGSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYLENEKLSSGKRQELVTK
IDHILDAL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgccggtcgccttgctgttgctgctgctgctatgtctcggggccttggccccg
acgcccggcagcgcctcctcggaggctccgccgctggtcaacgaggacgtgaagcgcacg
gtggacctgagcagccacctagccaaggtgacggctgaggtggtcctggtacacccgggc
ggcggctccacatcacgagccagctctttcgttctggccctggagccagaactggagtcg
cggcttgcgcacctaggcgtgcagataaagggagaagatgaggaagacaacaacctagaa
gtacgagaaaccaaaattaaagggaaaagtgggagatttttcacggtcaagctcccagtt
gctcttgatcctgggtccaagatctcggtcgttgtggaaactgtctacacccatgtgctt
catccgtatccgactcagataactcagtcagagaaacagttcgtcgtgtttgagggcaac
cattatttctactctccctatccaacaaagacccagaccatgcgagtgaaactggcgtcc
cgaaatgtggaaagctataccaagctggggaacccctcgagatctgaggacgtccttgat
tatgggccttttaaagacatccctgcctacagtcaggacactttcaaagtacattacgag
aacaatagccctttcctgaccatcaccagtatgacccgggtcatcgaggtatctcactgg
ggcaatattgctgtggaagagaacgtggacttgaagcacacgggcgcagtgctgaagggg
cctttctcccgctacgattaccagaggcagcctgacagtgggatctcctccattcgttct
tttaagaccatccttcctgctgccgcccaggatgtctattaccgggatgagattggtaat
gtttccaccagccacctccttatcttggatgactctgtggaaatggaaatccggcctcga
tttcctctctttggagggtggaagacacactacatcgttggttacaacctcccaagctat
gaatacctctataatctgggtgaccagtatgcactgaagatgcggtttgtagaccacgtg
tttgatgagcaagtgatagattctctgacagtgaagatcatcttgcccgagggagccaag
aacatccaggtggacagtccctacgatatcagccgggccccagacgagctgcattatacc
tacctagacacgttcggccgcccggtgattgtggcttacaagaagaatctcgtcgagcaa
cacattcaggacattgtggtgcactacacgttcaacaaggttctcatgctgcaggagccg
ctgctggtcgtggccgccttctacatcctgttcttcaccgtcatcatctacgtccgtctg
gacttttccatcaccaaggatccagctgcagaagccaggatgaaagtggcctgtatcaca
gagcaggtcttaaccctggtcaacaagaggctgggcctctaccgtcactttgatgagact
gtcaatagatacaagcagtcccgggatatctctaccctcaacagtggcaagaagagccta
gagacagagcacaaggctgtgaccagcgagattgctgtactgcagtctcggctgaagacg
gagggctcagacctgtgtgacagggtgagtgagatgcagaagctggacgcccaggtcaag
gagctggtcctgaagtcggcggtagaagcagagaggctggtggctggcaagctcaagaag
gatacgtacctggaaaacgagaagctcagctcaggaaaacgccaggagctggtcaccaag
atcgaccacatcctggatgctctgtag

DBGET integrated database retrieval system