KEGG   Mus musculus (mouse): 103988Help
Entry
103988            CDS       T01002                                 

Gene name
Gck, GLK, Gk, Gls006, HK4, HKIV, HXKP, MODY2
Definition
glucokinase (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Insulin secretion
Prolactin signaling pathway
Type II diabetes mellitus
Maturity onset diabetes of the young
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    103988 (Gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103988 (Gck)
   00052 Galactose metabolism
    103988 (Gck)
   00500 Starch and sucrose metabolism
    103988 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    103988 (Gck)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    103988 (Gck)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    103988 (Gck)
   04910 Insulin signaling pathway
    103988 (Gck)
   04917 Prolactin signaling pathway
    103988 (Gck)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    103988 (Gck)
   04950 Maturity onset diabetes of the young
    103988 (Gck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     103988 (Gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A1; 11 3.88 cM
AA seq 465 aa AA seqDB search
MAVDTTRRGAQSLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDESSVNPGQQLYEKIIGGKYMGE
LVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRRQILNILSTLGLRPS
VADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggatactacaaggaggggagcccagtcgttgactctggtagagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaagctggagacccatcaggaggccagtgtaaagatgttgcccacc
tacgtgcgttccaccccagaaggctcagaagttggagactttctctccttagacctggga
ggaaccaacttcagggtgatgctggtgaaagtgggggagggggaggcaggacagtggagc
gtgaagacgaaacaccagatgtattccatccccgaggacgccatgacgggcactgcggag
atgctctttgactacatctctgagtgcatctctgacttcctggacaagcatcagatgaaa
cacaagaaactacccctgggcttcaccttctccttccctgtaaggcacgaagacatagac
aagggcatcctgctcaactggaccaagggcttcaaggcctccggagcagaagggaacaac
atcgtgggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaatgacacggtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcaccggctgcaacgcctgctacatggaggagatgcagaat
gtggagctggtggaaggcgatgaggggcgcatgtgtgtcaacacagagtggggcgccttc
gggaactccggtgagctggacgagttcctcctggagtacgaccggatggtggatgagagc
tcagtgaaccccggtcagcagctgtacgaaaagatcattggcggaaagtacatgggcgag
ctggtacgacttgtgctgctcaagctggtagaggagaatcttctgttccacggagaggcc
tcagagcagctgcgcacacgtggtgcttttgagacccgttttgtgtcgcaggtggagagc
gactctggggaccgaaggcagatccttaacatcctgagcactctgggccttcgaccctct
gtcgccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccac
atgtgctcagcaggactagcgggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcacggtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcattgaa
tcagaggagggcagcggcaggggagccgcactggtctctgcggtggcctgcaagaaggct
tgcatgctgggccagtga

DBGET integrated database retrieval system