KEGG   Mus musculus (mouse): 104158Help
Entry
104158            CDS       T01002                                 

Gene name
Ces1d, Ces3, TGH
Definition
carboxylesterase 1D (EC:3.1.1.1 3.1.1.67)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104158 (Ces1d)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     104158 (Ces1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C5; 8
AA seq 565 aa AA seqDB search
MGLYPLIWLSLAACTAWGYPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPL
GSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLN
IYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLF
HRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKL
NLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPT
LMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMA
DVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLK
DGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDK
EVSFWAELRAKESAQRPSHREHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctaccctctgatatggctttctcttgctgcgtgcacagcttgggggtaccca
tcctcaccacctgtggtgaacactgttaaaggcaaagtcctggggaagtatgtcaatttg
gaaggattcacacagcctgtggctgttttcctgggagtcccctttgccaagccccctctt
ggctccttgagatttgctccaccacagcctgcagagccctggagcttcgtgaagaacacc
acctcctacccgcctatgtgctctcaggatgctgttggagggcaggtgctctcagagctc
ttcaccaacaggaaggagaacattcctttacagttttctgaagactgcctctacctgaat
atttacactcctgctgacttgacaaagaacagcagactaccagtgatggtgtggatccat
ggaggtggactggtggtgggcggagcatccacctatgatggactggccctctctgcccat
gaaaatgtggtggtggtgaccattcagtatcgccttggcatctggggattcttcagcact
ggggatgaacacagtcggggaaactggggtcacttggaccaggtggctgcactacgctgg
gtccaggacaacattgccaactttgggggcaacccaggctcggtgaccatctttggagag
tcagcaggaggtttcagtgtctctgttcttgtcttgtctcctttggccaagaacctcttc
cacagggccatttctgagagtggtgtgtccctcactgctgctctgattacaacagatgta
aagcccattgctggtctggttgctactctttctgggtgtaaaactaccacatcagctgtt
atggttcattgcctgcgccagaagacagaggatgaactactggagacctcactaaaattg
aatctttttaaactggacttacttggaaatccaaaagagagctatcccttcctccctact
gtgattgatggagtagttctgccaaaggcaccagaagagatcctggctgagaagagtttc
agcactgtcccctacatagtgggcatcaacaagcaagagtttggctggatcattccaacg
cttatgggctatccactcgctgaaggcaaactggaccagaagacagccaattctctcttg
tggaagtcctacccaacacttaaaatctctgagaatatgattccagtggtcgctgagaag
tatttaggagggacagatgacctcaccaaaaagaaagacctgttccaggacttgatggct
gatgtggtatttggtgtcccatcagtgattgtgtctcgaagtcacagagatgctggagcc
tccacctatatgtatgagtttgagtatcgcccaagctttgtatcggccatgagacccaag
gcagtaataggagaccatggtgatgagatcttctcagtatttggatctccatttttaaaa
gatggtgcctcagaagaggagaccaacctcagcaagatggtgatgaaattctgggccaac
tttgctcggaatgggaaccccaatggtggagggctgccccactggccagaatatgaccag
aaggaagggtatctgaagattggtgcctcaactcaggcagcccagaggctgaaggacaaa
gaagtgagtttttgggctgagctcagggccaaggagtcagcccagaggccatcccacagg
gaacatgttgagctctga

DBGET integrated database retrieval system