KEGG   Mus musculus (mouse): 104416Help
Entry
104416            CDS       T01002                                 

Gene name
Bap1, 2300006C11Rik, AA989761, AW553466, mKIAA0272, uch-x4
Definition
Brca1 associated protein 1 (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     104416 (Bap1)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   104416 (Bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 B; 14
AA seq 728 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YETRLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKPASSKSPLGLEAGR
TPVASECTQTDGAEEVAGSCPQTTTHSPPSKCKLVVKPPGSSLNGVPPNPAPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRAPQQYSEDEDDYEDEDEDVQNTNPAIRYKRK
GTGKPGSLSNSSDGQLSVLQPNTINVLTEKLQESQKDLSVPLSIKTSSGAGSPAVAVPTH
SQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRV
DCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSTRSSQGSQGSSGLEEK
EVVEVTESRDKPGLNRSSEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFK
IDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRS
RPYKAKRQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagtgacccaggcctcttcaccctcctggtggaa
gatttcggtgtcaaaggggtgcaagtggaggagatctatgaccttcagagtaaatgccag
gggcctgtgtatggatttatcttcctgttcaaatggatcgaagagcgcaggtcccgccgc
aaggtttctacgttggtggatgacacgtctgtgattgatgatgatattgtgaataacatg
ttctttgctcaccagctgattcccaactcttgtgccactcacgccttgctaagcgtgctt
ctgaactgcagcaatgtggatctggggcccacgctgagccgaatgaaggatttcaccaaa
ggcttcagtcctgagagcaaaggatatgcaattggcaatgcccctgaactggccaaggca
cataatagccatgccaggccagaaccacgtcaccttcctgagaaacagaatggcctcagt
gcagtgcggaccatggaggcgtttcattttgtcagctatgtgcctatcacagggaggctc
tttgaattggatggattgaaagtctacccaattgatcatgggccctggggagaggacgag
gagtggacagataaagctcgaagggtcatcatggagcgaatcggtcttgctactgcaggg
gagccctatcatgacattcgcttcaacctgatggcagtggtgcctgaccgcaggattaag
tatgagaccaggctacatgtactgaaggtgaaccgacaaacagtcctggaggccctgcag
cagctgattagagtaacccagccggagctgattcagacccacaaatctcaagagtcacag
ctgcctgaggagagcaagccagccagcagcaagtccccccttggactggaggcaggcaga
accccagtggcctctgagtgcactcagacagatggtgcagaggaggtggctggttcgtgc
ccacaaactacaacccatagtcctcccagcaaatgtaagctggtggtgaagcctccaggg
agcagcctcaatggggttcccccaaaccctgcccctattgtccagcggctgccagccttc
ctagacaatcacaattatgccaaatcccctatgcaggaggaggaagacctggcggcagga
gtgggtcgcagccgcgttcccgtccgagcgccccagcagtactctgaagacgaggatgac
tacgaggatgaggacgaggacgtgcagaacaccaaccctgccatcagatacaagcggaag
gggacagggaagccaggatcgttgagcaattcttcagatgggcagctgtcagtgctgcag
cccaacaccatcaatgtcttaactgagaagcttcaagagtctcagaaagacctttcagtt
cctctgtccatcaagactagcagtggggctgggagtccagctgtggctgtgcccacacac
tcgcaaccttcacccacccctagcaatgagagcacggacacagcctctgagattggcagt
gctttcaactcacccttgcgctcgcccatccgctcggccaacccaacacggccctctagc
cctgtcacctctcacatctccaaggtgctttttggagaagatgacagcctacttcgtgtt
gactgcatacgctacaaccgtgctgtccgtgacctgggtcctgtcattagcacgggcctg
ctgcaccttgctgaagatggtgtactgagtcccctggcactcacagagggtgggaagggt
tcctcaccttctaccagatcaagccaaggcagccaggggtccagtggcctagaggagaag
gaggtggtggaagtcacagagagcagagacaagcctgggctgaacaggtccagtgagccc
ttgagtggagagaagtactcacccaaggagctgctagcactgctaaagtgtgtagaagcc
gagattgcaaactatgaggcctgtctcaaggaggaggtggagaaaaggaagaagttcaag
attgatgaccagcgaaggacccacaactatgacgagtttatctgtaccttcatatccatg
ctggctcaggaaggaatgctggccaacctagtggaacagaacatctcagtgcgccggcgc
caaggggtcagcattgggcggcttcacaagcagcggaagcctgaccggcggaaacgctct
cgcccctacaaggccaaacgccagtga

DBGET integrated database retrieval system