KEGG   Mus musculus (mouse): 104816Help
Entry
104816            CDS       T01002                                 

Gene name
Aspg, A530050D06Rik, AI429460, Gm690
Definition
asparaginase homolog (S. cerevisiae) (EC:3.1.1.5 3.1.1.47 3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     104816 (Aspg)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     104816 (Aspg)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     104816 (Aspg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 F1; 12
AA seq 564 aa AA seqDB search
MARAMGPERRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLKTLHMFHDEEYAQAHSLPEDT
LVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMA
FAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGL
LRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLLQELRVAAEQGLIIVNCTHCL
QGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDRKKLLAKDLRGEM
TLPATDVLLQDGMLGCRVAWLLSMNGSQEADTMKDVLLPGLALAAAHAGDLDTLQAFVEL
DRDLNLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGRHQSVI
GLLRAAGARLSPQELEDVGTELCRLASRGDSEGLRAWWQAGADLGQPDYDGHCALQVAEA
AGNADVVALLQSFKDSVCAQPQPH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgctatgggaccagagcggcggctgctggccatttacactggcggcaccatc
ggcatgcggagcgaaggcggagtgttggtacctggcagaggcctggctgccgtcctgaag
acacttcacatgttccacgatgaagagtatgcacaggcccacagcctgcccgaggatacg
ctggtgctgcccccggccagccctgaccagaggatcatctacacggtgctggagtgccag
ccactcttcgactccagtgacatgaccatcactgagtgggttcagattgcccaaaccata
gagagacactacgcacagtaccagggctttgttgtcatccatggcacagacaccatggcc
tttgctgcctcagtgctctctttcatgctggaaaatctgcagaaaccagtcgtcctcacg
ggtgcccaggtacctatccacgcactgtggagtgacggccgtgagaacctgctgggggct
ctgctcatggctggccaatacgtcatccctgaggtctgcctgttcttccagaatcagctc
ttccggggcaatcggacaaccaaggtggacgctcggaggtttgccgccttctgctcccct
aacctgccccctctagccactgtgggcgcggatgtcacaatcaaccgtgagctggtacgg
aaggcctgcgggaagagccatctggtggtccacagtagcatggagcctgacgtgggccta
ctgcgcctctaccctggaattcccgcctccctggtccggaccttcctccagcccccactg
aaaggcgtggtcatggagaccttcggctctgggaatgggcccaccaagccagacctacta
caggagcttcgggtggcggccgaacaaggcctgatcattgtcaactgtacccattgcctt
cagggggctgtgacttcggactatgcatctggcatggccatggcaggagctggcatagtc
tcgggcttcgacatgacatcagaggctgccctggccaaactgtcctatgtgctgggccag
ccagggctgagcctgaatgacaggaagaagctgctggccaaggatcttcgtggggagatg
acgctgcctgcaacagatgtcttgctgcaggatggcatgctgggctgcagggtagcttgg
cttctcagtatgaatggcagccaggaggctgataccatgaaggatgttcttctgcccggc
ctggccctggctgcagctcacgctggtgacctggacaccctgcaggcctttgtggaactg
gacagagacctaaacctgaaggactatagtggtcaaaccccactgcatgtggctgcacgg
aggggccatgccgcagtggttaccatgctgctgcagaggggtgcggatgtggatgcccgt
aatgaggatggtcagagcccactattgctggccgtgaggggcaggcatcagagtgtcatt
gggctgctgagagctgctggggcccgcctgtctccccaggagctggaggacgttgggaca
gagctgtgcaggctggcatcaaggggagacagcgaaggcctgcgggcatggtggcaggct
ggggctgacctgggacagccagactatgatggacactgtgccctgcaagtagctgaagca
gctggaaatgcagatgtggtggccctgctacagagctttaaggacagtgtctgtgcccag
ccccagccccactag

DBGET integrated database retrieval system