KEGG   Mus musculus (mouse): 104923Help
Entry
104923            CDS       T01002                                 

Gene name
Adi1, AL024210, Fe-ARD, MTCBP-1, Ni-ARD
Definition
(RefSeq) acireductone dioxygenase 1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104923 (Adi1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     104923 (Adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     104923 (Adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3 Cupin_8
Motif
Other DBs
NCBI-GeneID: 104923
NCBI-ProteinID: NP_598813
MGI: 2144929
Ensembl: ENSMUSG00000020629
Vega: OTTMUSG00000022994
UniProt: Q99JT9
Structure
PDB: 

Jmol
Position
12; 12 A2
AA seq 179 aa AA seqDB search
MVQAWYMDESTADPRKPHRAQPDRPVSLEQLRTLGVLYWKLDADKYENDPELEKIRKMRN
YSWMDIITICKDTLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRPADHFDARVQYMSFLEGTA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgagtccaccgccgacccgcggaagccccaccgcgca
cagcccgaccgccccgtgagcctggagcagctgcgcacgctcggagtgctctattggaag
ctagatgctgacaagtatgagaacgatccagaactggaaaagatccggaaaatgagaaac
tactcctggatggacatcatcaccatatgcaaagatacacttcccaattacgaggagaag
atcaagatgttctttgaggaacatctgcatctggatgaggagatccgctacatcctggag
ggtagtgggtacttcgatgtcagggacaaggaggacaagtggatccggatttccatggag
aagggggacatgattactcttcctgccggcatctatcaccgcttcacactggacgagaag
aattacgtgaaggccatgcggctgtttgttggagaacctgtgtggacaccatacaaccgg
ccagctgaccattttgatgcccgtgtacagtacatgagttttttggaaggaacagcatag

DBGET integrated database retrieval system