KEGG   Mus musculus (mouse): 105787Help
Entry
105787            CDS       T01002                                 

Gene name
Prkaa1, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    105787 (Prkaa1)
   04068 FoxO signaling pathway
    105787 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    105787 (Prkaa1)
   04152 AMPK signaling pathway
    105787 (Prkaa1)
   04150 mTOR signaling pathway
    105787 (Prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    105787 (Prkaa1)
  Cellular community - eukaryotes
   04530 Tight junction
    105787 (Prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    105787 (Prkaa1)
   04922 Glucagon signaling pathway
    105787 (Prkaa1)
   04920 Adipocytokine signaling pathway
    105787 (Prkaa1)
   04921 Oxytocin signaling pathway
    105787 (Prkaa1)
  Aging
   04211 Longevity regulating pathway - mammal
    105787 (Prkaa1)
   04213 Longevity regulating pathway - multiple species
    105787 (Prkaa1)
  Environmental adaptation
   04710 Circadian rhythm
    105787 (Prkaa1)
   04714 Thermogenesis
    105787 (Prkaa1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    105787 (Prkaa1)
   05410 Hypertrophic cardiomyopathy (HCM)
    105787 (Prkaa1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105787 (Prkaa1)
   04931 Insulin resistance
    105787 (Prkaa1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105787 (Prkaa1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   105787 (Prkaa1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    105787 (Prkaa1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105787 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    105787 (Prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 105787
NCBI-ProteinID: NP_001013385
MGI: 2145955
Ensembl: ENSMUSG00000050697
UniProt: Q5EG47 Q3TUQ7 Q8BUX6
Position
15; 15 A1
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRAAIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSDVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgcttggtgtcggcaccttcgggaaa
gtgaaggtgggcaagcacgagttgaccggacataaagtggctgtgaagatactcaaccgg
cagaagattcggagccttgacgtggtgggaaaaatccgccgggagattcagaacctgaag
ctgttcaggcaccctcacatcatcaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctctggaggagagctatttgattatatctgtaaaaatgga
aggttggacgaaaaggaaagccgccgtctgttccagcagatcctttccggtgtggattat
tgtcacaggcatatggtggtccacagagatttgaaacctgagaacgtcctgcttgatgca
cacatgaatgcaaagatagccgactttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagctgtggctcacccaattatgccgcaccagaagtcatttcaggaagattg
tacgcaggccccgaggtggacatctggagcagcggggtcattctctatgctttgctgtgt
ggaaccctcccttttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttttatacccctcagtacttaaacccttcagtaatcagccttttgaaacatatgctg
caggtggatcccatgaagagggccgcaataaaagatatcagggaacacgagtggtttaaa
caggaccttccgaagtatctctttcctgaggacccatcttatagttcaaccatgatcgat
gacgaagccttgaaagaagtgtgtgagaagttcgagtgttcggaggaggaggtcctcagc
tgcctgtacaacagaaaccaccaggacccactagccgtcgcctaccacctcatcatagac
aacaggagaataatgaatgaagccaaagatttctacctagcaaccagcccacctgactct
ttcctggacgaccaccatttaactcggcctcaccctgaaagagtaccgttcttggttgcc
gaaacaccacgggcccggcacaccctggatgaattaaacccacagaaatccaaacaccaa
ggtgtacggaaggcaaaatggcatttgggaattcgaagtcaaagccgacccaatgatatc
atggcagaagtttgtagagcaatcaagcagttggattatgaatggaaggttgtaaacccc
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacattttccaaaatgagtcta
cagctataccaagtggatagtaggacttacttgttggatttccgtagtattgatgatgag
attacagaagccaaatcagggactgctactccacagagatcgggatccatcagcaactat
cgatcttgccaaaggagtgactctgatgccgaagctcaaggaaagccctcagacgtctcc
cttacctcatctgtcacctccctcgactcctcccctgtcgacgtagctccaagaccagga
agtcatacaatagaattttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system