KEGG   Mus musculus (mouse): 106504Help
Entry
106504            CDS       T01002                                 

Gene name
Stk38, 5830476G13Rik, 9530097A09Rik, AA617404, Ndr1
Definition
(RefSeq) serine/threonine kinase 38 (EC:2.7.11.1)
  KO
K08790  
serine/threonine kinase 38 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106504 (Stk38)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  NDR family
   106504 (Stk38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A3.3
AA seq 465 aa AA seqDB search
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDE
EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKIL
RKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMK
KDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKA
HRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRF
CCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacaggatcaacaccttgctcatccatgagtaatcatacgaaggagagggtg
acaatgaccaaagtgacactggagaatttttatagcaaccttatcgctcaacatgaagaa
cgagaaatgagacaaaagaagttagaaaaggtgatggaagaagaaggcctgaaagacgaa
gagaaacgactcagaagatccgcgcacgctcggaaggaaacagagtttcttcgattaaag
agaacaaggcttggactggaagattttgagtctttaaaagtcataggccgaggagcattt
ggtgaggtgcggcttgttcagaagaaagacacagggcatgtgtacgcaatgaaaatcctg
cgcaaagcagacatgctcgagaaggagcaggttggccacattcgtgcggagcgtgacatt
ctagtggaggcagacagtttgtgggttgtgaaaatgttctatagttttcaggataagcta
aacctctacctaatcatggagttcctgcctggaggggacatgatgactttattgatgaaa
aaagatactctgacagaagaggagactcagttttatatagcagagacagtattagccata
gactccattcaccagctgggattcatccacagagatatcaagccagacaaccttctcttg
gacagcaagggccatgtgaaactttccgactttggcctttgcacaggcctgaaaaaagca
cacaggacagaattttataggaacctgaaccacagcctgcccagtgatttcacttttcag
aacatgaattccaaaaggaaagcagagacctggaaaagaaacagacgccagctagccttc
tctacagtgggcactcctgactacattgctccagaggtgttcatgcagacgggttacaac
aagctctgcgattggtggtcgctcggggtaatcatgtatgagatgctcatcggctaccca
ccattctgctccgagaccccacaagagacatacaagaaagtgatgaactggaaggaaact
ttgacctttcctccagaagttcctgtctccgagaaagccaagggcctgattctgaggttc
tgctgtgaatgggaacatagaatcggagcccctggagttgaagaaataaaaaataatctt
ttttttgaaggtgttgactgggaacacatcagggagagaccagctgcgatatctattgaa
atcaagagcatcgatgatacctcaaacttcgatgaatttccagagtctgatattcttaag
cccacagtgaccacaagtagtcatcctgagacggactacaagaacaaagactgggtcttc
atcaattacacatacaagcgcttcgagggcctgacagccaggggggccataccttcgtac
atgaaagcagcaaaatag

DBGET integrated database retrieval system