KEGG   Mus musculus (mouse): 107435Help
Entry
107435            CDS       T01002                                 

Gene name
Hat1, 2410071B14Rik, AA536933, Hat-1, KAT1
Definition
histone aminotransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Class
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C2; 2
AA seq 416 aa AA seqDB search
MAALEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDD
ETAFGYKGLKILLYYIAGSLSTLFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNT
NDFLSLLEKETNFKPFGTLLHTYTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLM
WFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLI
LTPFQGQGHGAQLLETVHRYYISFPTVLDITAEDPSRSYLKLRDFVLVKFCQFLPSFSRE
RLLQGFSEDMAIQAQQMFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPY
KKKQRDLAKMKKCLRPEELTNQMNQIEISVQHEQLEERFQELVEDYRRVIERLAQE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttggagaaatttctggtggagtataagagtgccgtggagaagaaactagca
gagtacaagtgtaacaccaacacagcaatcgagctgaaactagttcgttttcctgaagat
cttgagaatgacattagaactttctttcctgaatatacccatcagctctttggggatgat
gaaactgctttcggttacaagggcctgaagatcttgctgtactatattgctggtagcctg
tcaacactgttccgtgttgaatattcatctaaagttgatgagaactttgattgtgtggag
gcagatgatgttgaaggcaaaatcagacaaatcattccacctgggttttgcacaaacaca
aatgattttctttccttgctggaaaaggaaactaatttcaagccttttggaaccctcctc
catacatacacagttcctagtcagacaggaggtgaaacctttactttccagatccacaag
gctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatg
tggtttattgaaactgctagctttattgacgtggatgatgaaagatggcactactttcta
gtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggctacatgaca
gtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgata
ctgactccatttcaaggtcagggccacggtgctcaacttcttgaaacagttcatagatac
tacatttcatttcctacagttcttgatattacagcggaagatccgtccagaagctatttg
aaactaagagactttgtgcttgtgaagttttgtcaatttttgcccagtttctcccgggaa
agattactgcaaggattcagtgaagatatggcaatacaggcacagcaaatgttcaaaata
aataagcaacatgctagaagggtttatgaaattcttcgactgctggtgactgacatgagc
gatgctgagcaatacagaagctacagactggatattaaaagaagactaattagcccttac
aagaaaaagcagagggatcttgccaagatgaagaaatgcctgagaccagaagagctgaca
aatcagatgaaccagatagaaataagtgtgcagcatgagcagctggaagagagatttcag
gagctggtggaggactaccggcgtgtcattgagcgacttgctcaagagtga

DBGET integrated database retrieval system