KEGG   Mus musculus (mouse): 107435Help
Entry
107435            CDS       T01002                                 

Gene name
Hat1, 2410071B14Rik, AA536933, Hat-1, KAT1
Definition
(RefSeq) histone aminotransferase 1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    107435 (Hat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     107435 (Hat1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    107435 (Hat1)
   HAT complexes
    HATB complex
     107435 (Hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Myb_DNA-bind_4 Acetyltransf_7 Glyco_hydro_46 Acetyltransf_1 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 107435
NCBI-ProteinID: NP_080391
MGI: 96013
Ensembl: ENSMUSG00000027018
Vega: OTTMUSG00000013187
UniProt: Q8BY71
Position
2; 2 C2
AA seq 416 aa AA seqDB search
MAALEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDD
ETAFGYKGLKILLYYIAGSLSTLFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNT
NDFLSLLEKETNFKPFGTLLHTYTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLM
WFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLI
LTPFQGQGHGAQLLETVHRYYISFPTVLDITAEDPSRSYLKLRDFVLVKFCQFLPSFSRE
RLLQGFSEDMAIQAQQMFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPY
KKKQRDLAKMKKCLRPEELTNQMNQIEISVQHEQLEERFQELVEDYRRVIERLAQE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttggagaaatttctggtggagtataagagtgccgtggagaagaaactagca
gagtacaagtgtaacaccaacacagcaatcgagctgaaactagttcgttttcctgaagat
cttgagaatgacattagaactttctttcctgaatatacccatcagctctttggggatgat
gaaactgctttcggttacaagggcctgaagatcttgctgtactatattgctggtagcctg
tcaacactgttccgtgttgaatattcatctaaagttgatgagaactttgattgtgtggag
gcagatgatgttgaaggcaaaatcagacaaatcattccacctgggttttgcacaaacaca
aatgattttctttccttgctggaaaaggaaactaatttcaagccttttggaaccctcctc
catacatacacagttcctagtcagacaggaggtgaaacctttactttccagatccacaag
gctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacctttttgatg
tggtttattgaaactgctagctttattgacgtggatgatgaaagatggcactactttcta
gtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggctacatgaca
gtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcagatgctgata
ctgactccatttcaaggtcagggccacggtgctcaacttcttgaaacagttcatagatac
tacatttcatttcctacagttcttgatattacagcggaagatccgtccagaagctatttg
aaactaagagactttgtgcttgtgaagttttgtcaatttttgcccagtttctcccgggaa
agattactgcaaggattcagtgaagatatggcaatacaggcacagcaaatgttcaaaata
aataagcaacatgctagaagggtttatgaaattcttcgactgctggtgactgacatgagc
gatgctgagcaatacagaagctacagactggatattaaaagaagactaattagcccttac
aagaaaaagcagagggatcttgccaagatgaagaaatgcctgagaccagaagagctgaca
aatcagatgaaccagatagaaataagtgtgcagcatgagcagctggaagagagatttcag
gagctggtggaggactaccggcgtgtcattgagcgacttgctcaagagtga

DBGET integrated database retrieval system