KEGG   Mus musculus (mouse): 107476Help
Entry
107476            CDS       T01002                                 

Gene name
Acaca, A530025K05Rik, Acac, Acc1, Gm738
Definition
acetyl-Coenzyme A carboxylase alpha (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mmu  Mus musculus (mouse)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    107476 (Acaca)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    107476 (Acaca)
   00640 Propanoate metabolism
    107476 (Acaca)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    107476 (Acaca)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    107476 (Acaca)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    107476 (Acaca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107476 (Acaca)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     107476 (Acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     107476 (Acaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 C; 11
AA seq 2345 aa AA seqDB search
MDEPSPLAKTLELNQHSRFIIGSVSEDNSEDEISNLVKLDLEEKEGSLSPASVSSDTLSD
LGISGLQDGLAFHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKV
LIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGG
PNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALG
DKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAA
EEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQ
ILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAG
TVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYG
VSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYF
SVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETE
SFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQVL
PAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGS
SYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAE
IEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQS
TALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQD
IMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVF
FMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDM
NTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRA
RQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHS
NQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMS
FASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFRTFEDFVRIFDEIMGCFCDSPP
QSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVE
HGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQL
ELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEY
LQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGS
RLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAY
GDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAF
LPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPDGRDIIVIG
NDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDP
EDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSG
MIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGRE
VYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPIDR
IIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGI
PVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLM
VFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTIN
PRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTER
KELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRR
LLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEE
DGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTM
DSPST
NT seq 7038 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccatctccgttggccaaaactctggagctaaaccagcactcccgattcata
attgggtctgtgtctgaagacaactcagaagatgagatcagtaacctggtgaagctggac
ctagaagagaaggagggctccctgtcaccagcctccgtcagctcagatacactttctgat
ttggggatctctggcttacaggatggtttggcctttcacatgagatccagcatgtctggc
ttgcacctagtaaaacaaggtcgagacagaaagaaaatagactcacaacgagatttcact
gtggcttctccagcagaatttgttactcgttttgggggaaataaagtaattgagaaggtt
cttatcgccaacaatggtattgcagcagtgaaatgcatgcgatctatccgtcggtggtct
tatgaaatgtttcgaaatgaacgtgcaatccgatttgttgtcatggttacacctgaagac
cttaaagccaatgcagaatacattaagatggcagaccactatgttccagtgcctggagga
cccaacaacaacaattacgcaaatgtggagttgattcttgatattgctaaaaggatacct
gtacaagcagtgtgggctggctggggtcatgcctctgagaacccgaaactcccagaactg
ctcttaaaaaatggcattgctttcatgggccctccaagccaggccatgtgggctttgggg
gataagattgcatcttctattgtggctcaaactgcaggtatcccaactcttccctggagt
ggcagtggtcttcgagtggattggcaagaaaatgatttttcgaaacgtatcttaaatgtt
ccacaggatctgtatgagaaaggctatgtgaaggatgtggatgatggtctgaaggcagct
gaggaagttggctatccagtgatgatcaaggcctcagagggaggaggagggaaagggatc
agaaaagttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtt
cctggatcacctatatttgtaatgagactagcaaaacaatctcgacatctggaggtccag
attctggcagatcagtatggcaatgctatttctttgtttggtcgtgactgctctgtgcag
cgcaggcatcagaagatcattgaagaagctcctgctgcgattgctaccccagcagtattt
gaacacatggaacagtgtgcagtgaaacttgccaaaatggttggttatgtgagtgctggg
actgtggaatacttgtacagccaggatggaagcttctactttttggaactgaaccctcgg
ctacaggttgaacatccttgtacagagatggtggctgatgtcaatcttcctgcagcacag
ctccagattgccatggggatccctctatttaggatcaaggatattcgtatgatgtatggg
gtatctccttggggagatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccacgtgattgctgctcggatcaccagtgaaaacccagatgaggggtttaagccc
agctctggaacagttcaggaacttaattttcgtagcaataagaacgtttggggttatttc
agtgttgctgctgctggaggacttcatgaatttgctgattctcagttcgggcactgcttt
tcctggggagaaaacagggaggaagcaatctcaaatatggtggtggcactgaaggagctg
tctattcggggtgactttcgaactacagtggaatacctcatcaaactgctggagacagaa
agctttcagcttaacagaatcgacactggctggctggacagactgatcgcagagaaagtg
caggcagagcgacctgacaccatgttgggagttgtgtgtggggctctccatgtagcagat
gtgagcctgaggaacagcatctctaacttccttcactccttagagaggggtcaagtcctt
cctgctcacacacttctgaacacagtagatgttgaacttatctatgaaggaatcaaatat
gtacttaaggtgactcggcagtctcccaactcctacgtagtgataatgaatggctcgtgt
gtggaagtggatgtgcatcggctgagtgatggtggcctgctcttgtcttatgacggcagc
agttacaccacatacatgaaggaagaggtggacagatatcgaatcacaattggcaataaa
acctgtgtgtttgagaaggaaaatgacccatctgtaatgcgctcaccgtctgctgggaag
ttaatccagtatattgtggaagatggcggacatgtgtttgctggccagtgctatgctgag
attgaggtaatgaagatggtgatgactttaacagctgtagaatctggctgcatccattat
gtcaaacgacctggagcagcacttgaccctggctgtgtgatagccaaaatgcaactggac
aaccccagtaaagttcaacaggctgagcttcacacgggcagtctaccacagatccagagc
acagctctcagaggcgagaagctccatcgagttttccactatgtcctggataacctggtc
aatgtgatgaatggatactgccttccagaccctttcttcagcagcagggtaaaagactgg
gtagaaagattgatgaagactctgagagacccctccttgcctctgctagagctgcaggat
atcatgaccagtgtctctggccggatccccctcaatgtggagaagtctattaagaaggaa
atggctcagtatgctagcaacatcacatcagtcctgtgtcagtttcccagccagcagatt
gccaacatcctagatagtcatgcagctacactgaaccggaaatctgagcgggaagtcttc
ttcatgaacacccagagcattgtccagctggtgcagaggtaccgaagtggcatccgtggc
cacatgaaggctgtggtgatggatctgctgcggcagtacctgcgagtagagacacagttt
cagaacggccactacgacaaatgtgtattcgcccttcgggaagagaacaaaagcgacatg
aacaccgtactgaactacatcttctcccacgctcaggtcaccaaaaagaatctcctggtg
acaatgcttattgatcagttatgtggccgggaccctacacttactgatgagctgctaaat
atcctcacagagctaacccaactcagcaagaccaccaacgctaaagtggcgctgcgcgct
cgtcaggttcttattgcttcccatttgccatcatatgagcttcgccataaccaagtagag
tctatcttcctatcagccattgacatgtatggacaccagttttgcattgagaacctgcag
aaactcatcctctcggaaacatctattttcgatgtcctcccaaactttttttaccacagc
aaccaggtggtgaggatggcagctctggaggtgtatgttcgaagggcttacattgcctat
gaactcaacagcgtacaacaccgccagcttaaggacaacacctgtgtggtggaatttcag
ttcatgctgcccacatcccatccaaacagagggaacatccccacgctaaacagaatgtcc
tttgcctccaacctcaaccactatggcatgactcatgtagctagtgtcagcgatgttctg
ttggacaacgccttcacgccaccttgtcagcggatgggcggaatggtctctttccggacc
tttgaagattttgtcaggatctttgatgaaataatgggctgcttctgtgactccccaccc
caaagccccacattcccagagtctggtcatacttcgctctatgatgaagacaaggtcccc
agggatgaaccaatacatattctgaatgtggctatcaagactgatggcgatattgaggat
gacaggcttgcagctatgttcagagagttcacccagcagaataaagctactttggttgag
catggcatccggcgacttacgttcctagttgcacaaaaggatttcagaaaacaagtcaac
tgtgaggtggatcagagatttcatagagaattccccaaatttttcacattccgagcaagg
gataagtttgaggaggaccgcatttatcgacacctggagcctgctctggctttccagtta
gagttgaaccggatgagaaattttgaccttactgccatcccatgtgctaatcacaagatg
cacctgtaccttggggctgctaaggtggaagtaggcacagaagtgactgactacaggttc
tttgttcgtgcgatcatcaggcactctgatctggtcacaaaggaagcttctttcgaatat
ctacaaaatgaaggggaacgactgctcctggaagctatggatgaattggaagttgctttt
aataatacaaatgtccgcactgactgtaaccacatcttcctcaactttgtgcccacggtc
atcatggacccatcaaagattgaagaatctgtgcggagcatggtaatgcgctatggaagt
cggctatggaaattgcgggtcctccaggcagaactgaaaatcaacattcgcctgacaaca
actggaaaagcaattcccatccgcctcttcctgacaaacgagtctggctactacttggac
atcagcctgtataaggaagtgactgactccaggacagcacagatcatgtttcaggcatat
ggagacaagcagggaccactgcatggaatgttaattaatactccatatgtgaccaaagac
cttcttcaatcaaagaggttccaggcacagtccttaggaacaacatatatatatgatatc
ccagagatgtttcggcagtcactcatcaaactctgggagtccatgtccacccaagcattt
cttccttcgcctcctttgccttccgacatcctgacgtatactgaactggtgttggatgat
caaggccagctggtccatatgaacagacttccaggaggaaatgagattggcatggtagcc
tggaaaatgagccttaaaagccctgaatatccagatggccgagatatcattgtcatcggc
aatgacattacatatcggatcggttcctttgggcctcaggaggatttgctgtttctcaga
gcttctgaacttgccagagcagaaggcatcccacgcatctacgtggcagcgaacagtgga
gctagaattggacttgcagaagaaatacgccatatgttccatgtggcctgggtagatcct
gaagatccctacaagggatacaagtatttatatctgacaccccaggattataagagagtc
agtgccctcaattctgtccactgtgaacatgtggaggatgaaggggaatccaggtacaag
ataacagatattatcgggaaagaagaaggacttggagcagagaaccttcggggttctgga
atgattgctggggaatcctcattggcttacgatgaggtcatcaccatcagcctggttaca
tgccgggccattggtattggggcttaccttgtccggctgggacaaagaaccatccaggtt
gagaattctcacttaattctgacaggagcaggtgccctcaacaaagtccttggtcgggaa
gtatacacctccaacaaccagcttgggggcatccagattatgcacaacaatggggttacc
cactccactgtttgtgatgactttgagggagtcttcacagtcttacactggctgtcatac
atgccgaagagcgtacacagttcagttcctctcctgaattccaaggatcctatagataga
atcatcgagtttgttcccacaaaggccccatatgatcctcggtggatgctagcaggccgt
cctcacccaacccagaaaggccaatggttgagtgggttttttgactatggatctttctca
gaaatcatgcagccctgggcacagaccgtggtagttggcagagccaggttagggggaata
cccgtgggagtagttgctgtagaaacccgaacagtggaactcagtatcccagctgatcct
gcgaacctggattctgaagccaagataatccagcaggccggccaggtttggttcccagac
tctgcatttaagacctatcaagctatcaaggactttaaccgtgaagggctacctctaatg
gtctttgccaactggagaggtttctctggtgggatgaaagatatgtatgaccaagtgctc
aagtttggcgcttacattgtggatggcttgcgggaatgttcccagcctgtaatggtttac
atcccgccccaggctgagcttcggggtggttcttgggttgtgatcgaccccaccatcaac
cctcggcacatggagatgtacgctgaccgagaaagcaggggatctgttctggagccagaa
gggacagtagaaatcaaattccgtaaaaaggatctggtgaaaaccatgcgtcgggtagat
ccagtttacatccgcttggctgagcgattgggcaccccagagctaagccccactgagcgg
aaggagctggagagcaagttgaaggagcgggaggagttcctaattcccatttaccatcag
gtagctgtgcagtttgctgacttgcacgacacaccaggccggatgcaggagaagggtgtc
attaacgatatcttggattggaaaacatcccgcaccttcttctactggaggctgaggcgc
ctcctgctggaggacctggtcaagaagaaaatccacaatgccaaccctgagctgactgac
ggccagatccaggccatgttgagacgctggtttgtagaagttgaaggcacagtgaaggct
tacgtctgggacaataataaggacctggtggagtggctggagaagcaactgacagaggaa
gatggcgtccgctctgtgatagaggagaacatcaaatacatcagcagggactatgtcctg
aagcagatccgcagcttggtccaggccaacccagaagtcgccatggactccatcgtccac
atgacccagcacatctcacccacccagcgagcagaagttgtaaggatcctctccactatg
gattccccttccacgtag

DBGET integrated database retrieval system