KEGG   Mus musculus (mouse): 107515Help
Entry
107515            CDS       T01002                                 

Gene name
Lgr4, 9130225G07, A330106J01Rik, A930009A08Rik, Gpr48
Definition
(RefSeq) leucine-rich repeat-containing G protein-coupled receptor 4
  KO
K04309  
leucine-rich repeat-containing G protein-coupled receptor 4
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   LGR like
    107515 (Lgr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 E3
AA seq 951 aa AA seqDB search
MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQ
ALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEF
PQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASLVQWFPNLAGTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNDIRDLPS
FNGCRALEEISLQRNQISLIKETTFQGLTSLRILDLSRNLIREIHSGAFAKLGTITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFQLKDALAARDFANLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSPQDHSVTKEKGATDAANATSTAESEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDVMKNGKSSHLR
QFQVAALVALLGAAIAGCFPLFHGGQYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKDDWKLLKRRVTRKHGSVSVSISSQGGCGEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPVLTVASCQRPEAYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVRD
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcccgctgcggctgctctgcttcttcgccctggggctgctcggctcggccggg
cccagcggcgcggcgccacctctctgcgctgcgccctgcagctgcgacggcgaccgtcgg
gtggactgctccgggaaggggttgacggcggtaccggaggggctcagcgccttcacccaa
gcactggatatcagtatgaacaatatcactcagttaccagaagatgcatttaagaatttt
ccttttctagaggagctacaactggctggtaacgacctttcttttatccacccaaaagcc
ttgtctgggttgaaagaactcaaagtcctaaccctccagaacaatcagttgaaaacagta
cccagtgaagccattcgtggactgagtgctttgcagtctctacgcttagatgccaaccat
attacctcagtcccggaggacagttttgaagggctcgttcagttgcggcatctgtggctg
gatgacaacatcttgacggaagtgcctgtgcgtccgctcagcaacctgccaaccctgcag
gcgctgaccttggctctcaacaacatctcaagcatccccgacttcgcattcaccaacctt
tcaagcttggtagtgctgcatcttcataacaataaaattaaaagcctcagtcaacactgt
tttgatggactagataacctggaaaccctggacttgaattataataacttggatgaattt
cctcaggctattaaagcccttcccagccttaaagagctgggatttcacagtaattctatt
tctgttatcccggatggagcatttgctggtaatccactgctaagaactatccatttgtat
gataatcctctgtcttttgtggggaactcagcatttcacaacctgtctgatctgcattcc
ttagtcattcgtggtgcaagcctggtgcagtggttccccaatctggccggaactgtccat
ctggagagtctaaccttgacagggacaaaaataagcagcatacctgatgatctgtgccaa
aaccaaaagatgctgcggactctggacttatcttataacgatataagagaccttccaagt
tttaatggttgtcgtgcattggaagaaatttcattgcagcgtaatcaaatctccctgata
aaggaaactacttttcaaggcctaacatccctaaggattctagatctgagtagaaacctg
attcgtgaaattcacagtggagcttttgcgaagcttgggacaattactaacctggatgtg
agtttcaatgaattaacctcatttcctacggaaggcctgaatgggctcaatcaacttaaa
cttgtgggtaacttccagctgaaagatgccttggcagccagagactttgccaatctcagg
tctctatcagtaccatatgcttatcagtgttgtgcattttgggggtgtgactcttatgca
aatttaaacacagaagataacagcccccaagaccacagtgtgacaaaagagaaaggtgct
acagatgcagcaaatgccaccagcactgctgaaagtgaagaacatagccaaataatcatc
cattgtacaccttcaacaggtgcttttaagccctgtgaatatttactgggaagctggatg
attcgccttacagtgtggttcattttcctggtcgccttgcttttcaacctgcttgtcatt
ttaacagtgtttgcgtcttgttcatcactgcctgcctccaagctcttcataggcttgatt
tctgtgtctaacttactcatgggcatctatactggcatccttacttttcttgatgctgtg
tcctggggccgatttgctgaatttggcatttggtgggaaactggcagcggctgcaaggta
gctgggtctctggcagtcttctcctcagagagcgccgtattcctgttaaccctggcagcc
gtggaaagaagcgtttttgcaaaggatgtaatgaaaaatgggaaaagcagtcacctccga
cagttccaggtggctgccctcgtagctttgctgggtgctgcaatagcaggctgcttcccc
ctttttcacggagggcaatattctgcatcacccttgtgcttgccatttcctacaggagag
acaccatcattaggattcactgtgaccctagtgctattaaactcactagcatttttattg
atggccattatctacactaaactctactgcaacttagagaaagaagacccgtcagaaaac
tcccagtctagcatgattaagcacgttgcttggctcatcttcacaaactgcatcttcttc
tgccctgttgcatttttctcattcgcaccattgatcacggcaatctccatcagccccgag
ataatgaagtctgttacgctgatattcttcccgctgcctgcttgcctgaatccagtcctg
tacgttttcttcaacccaaagtttaaagacgactggaagctcctgaagcggcgtgtcacc
aggaaacacggatcagtctcagtctccatcagcagccaaggcggttgtggggaacaggat
ttctactacgactgtggcatgtattcccacttgcagggtaacctgactgtctgtgactgc
tgtgagtcatttcttctgacaaaaccagtatcgtgcaaacacttaataaaatcgcacagt
tgtcctgtattgacagtggcctcttgccagaggccagaggcctactggtctgattgtggc
acacagtcggcccattctgactatgcagatgaagaggattcctttgtctcggacagctct
gaccaggtgcaggcctgtggacgagcctgcttctaccagagtcgcggattccctctggtg
cgctatgcttataatctaccgagagtcagagactga

DBGET integrated database retrieval system