KEGG   Mus musculus (mouse): 107650Help
Entry
107650            CDS       T01002                                 

Gene name
Pi4kb, ESTM41, PI4K-beta, PI4Kbeta, Pik4cb
Definition
(RefSeq) phosphatidylinositol 4-kinase, catalytic, beta polypeptide (EC:2.7.1.67)
  KO
K19801  
phosphatidylinositol 4-kinase B [EC:2.7.1.67]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107650 (Pi4kb)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    107650 (Pi4kb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     107650 (Pi4kb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2.1
AA seq 816 aa AA seqDB search
MGDMVVEPATLKPTSEPTPSPSGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVK
LLHGGVAISSKGTPLELVNGDGVDNEIRCLDDPPAQIREEEDEMGAGVASGTAKGARRRR
QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFYFRNEDVDFYLPQLL
NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLI
LSDELKPAHRKRELPTLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVEN
EDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLN
HKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCD
NISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEK
VRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI
LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
CLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGG
LNGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSM
TEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgggagacatggtagtggagcctgccaccctgaagccaacttctgagcctactcctagc
ccatcagggaataatgggggctccctactaagcgtcatcacggagggggtcggggaactg
tcagtgattgaccctgaggtggcccagaaggcctgccaggaggtactggagaaagtcaag
cttttgcatggaggtgtagccatctctagcaaaggcaccccgctggagttggttaatggg
gatggtgtggacaatgaaatccgttgcctagatgatccacctgcccagatcagggaggaa
gaagatgagatgggggctggtgtggcctctggcacagccaaaggagcaagacgacgacga
cagaacaactcagccaaacagtcttggctcctgaggctgtttgagtcaaaactatttgac
atctctatggctatttcatacttgtataactccaaggagcctggagtgcaagcctacatt
ggcaaccggctcttctactttcgcaatgaggatgtggacttctatttgccccagttgctt
aacatgtatatccacatggatgaggatgtgggcgatgccattaagccctacatagtccac
cgctgtcgccagagcatcaacttttccctccagtgtgccctgttgcttggggcctactct
tcagacatgcacatttccactcagcgacactcgcgagggaccaagttacggaagctaatc
ctctcagatgagctgaagccagctcaccgaaagagggagctgccgacattaagcccagcc
cctgacacagggctgtctccctctaaaaggactcaccagcgttctaagtcagatgctacg
gccagcataagtctcagcagcaacctgaaacgaacagccagcaaccctaaagtggagaat
gaggatgaggagctctcctccagcaccgagagtattgataattcattcagttcccctgtc
cggctggcccctgagcgagaattcatcaagtctttgatggcaatcggcaaacggctggcc
acgctccccactaaagagcaaaaaacacaaaggctgatctcagagctttccctgctcaac
cataagctccctgcccgagtctggctgcccacggctggctttgaccaccacgtggtccgt
gtgccccacacacaagctgttgttctcaattccaaggataaggctccctacctgatctac
gtggaagttctcgaatgtgaaaactttgacacaactagtgttcctgcccggattcctgaa
aaccgaattcggagtacacggtctgtagagaacctgcctgaatgtggtatcactcatgag
cagcgagctggcagcttcagcactgtgcccaattatgacaatgatgatgaagcctggtca
gtggatgatataggcgagctgcaagtggagctccctgaagtgcacaccaacagctgtgac
aacatctcccagttctcggtggacagcatcaccagccaggagagcaaggagcctgtgttc
attgcagcaggggacatccgacggcgcctttcagaacagctggctcatactcctacagcc
ttcaaacgagaccctgaagacccttctgcagttgccctcaaagagccctggcaggagaaa
gtgcggaggatcagagaaggttccccgtatggccatcttcccaattggcgactcctttca
gtcattgtcaagtgtggagatgaccttcgccaggagctgctggctttccaggtgttgaaa
caactgcagtccatttgggaacaggagcgagtgcctctttggatcaagccatataagatt
cttgtgatttcagctgacagtggcatgattgaaccagtagtcaacgctgtgtccatccac
caggtgaagaaacagtcacagctctccttgctcgattacttcctacaggaacatggcagt
tataccactgaggcattcctcagtgcccagcgcaattttgtgcaaagctgtgctggctac
tgcttggtctgctacctattgcaagtcaaggacaggcacaacgggaacatccttctggac
gcagaaggtcacatcatccacatcgactttggcttcatcctttccagctcaccccgaaac
ctgggcttcgagacatcagcctttaagctgaccacagaatttgtggatgtaatgggtggc
ctgaacggtgatatgttcaactactacaagatgctcatgctgcaagggctgattgctgct
cggaagcacatggacaaggtggtacagattgtggagatcatgcagcaaggttctcagctt
ccttgcttccatggctccagcaccattcgcaacctcaaagagaggttccacatgagcatg
actgaggagcagctgcagctgctggtggagcagatggtggacggcagcatgaggtccatc
accaccaaactctacgatggcttccagtacctcaccaatggcatcatgtga

DBGET integrated database retrieval system