KEGG   Mus musculus (mouse): 107823Help
Entry
107823            CDS       T01002                                 

Gene name
Whsc1, 5830445G22Rik, 9430010A17Rik, AW555663, C130020C13Rik, D030027O06Rik, D930023B08Rik, MMSET, NSD2, Whsc1l, mKIAA1090
Definition
Wolf-Hirschhorn syndrome candidate 1 (human) (EC:2.1.1.43)
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107823 (Whsc1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    107823 (Whsc1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107823 (Whsc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B1; 5
AA seq 1366 aa AA seqDB search
MEFSIRKSPLSVQKVVKCMKMKQTPEILGSANGKTQNCEVNHECSVFLSKAQLSNSLQEG
VMQKFNGHDALPFLPAEKLKDLTSCVFNGEPGAHDTKLCFEAQEVKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAADVSQSEENEQKSDNKTRRNRKRSIKYDSLLE
QGLVEAALVSKISSPADKKIPVKKESCPNTGRDRDLLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHNHTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEEQFEKLCQESAKQ
APTKAEKIKLLKPISGRLRAQWEMGIVQAEEAASMSIEERKAKFTFLYVGDQLHLNPQVA
KEAGIVTEPLGEMVDSSGASEEAAVDPGSVREEDIPTKRRRRTKRSSSAENQEGDPGTDK
STPPKMAEAEPKRGVGSPAGRKKSTGSAPRSRKGDSAAQFLVFCQKHRDEVVAEHPDASG
EEIEELLGSQWSMLNEKQKARYNTKFSLMISAQSEEDSGNGNGKKRSHTKRADDPAEDVD
VEDAPRKRLRADKHSLRKQRETITDKTARTSSYKAIEAASSLKSQAATKNLSDACKPLKK
RNRASATASSALGFNKSSSPSASLTEHEVSDSPGDEPSESPYESADETQTEASVSSKKSE
RGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCTECASGIHSCFV
CKESKMEVKRCVVNQCGKFYHEACVKKYPLTVFESRGFRCPLHSCMSCHASNPSNPRPSK
GKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHTHVNVSWCFVCSK
GGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVC
HPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFK
NALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCK
PTDENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVA
KRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRF
MNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCS
GFLGDRPKTSASLSSEEKGKKAKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFC
TKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFRSTQDG
QSYCCEHDLRADSSSSTKTEKPFPESLKSKGKRKKRRCWRRVTDGK
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcagaaaaagtcctctttctgttcagaaagttgtaaagtgcatgaag
atgaagcagacaccagaaatccttggcagtgcaaatggaaagactcagaactgtgaagtg
aatcatgaatgttctgtattcctcagcaaagctcaactttctaacagcctacaggagggg
gtcatgcagaaatttaatggccatgatgcgctcccctttcttccagcagagaagttgaaa
gatcttacttcttgtgtttttaatggagaacctggtgctcatgatactaaattgtgtttt
gaggcccaggaagtaaaaggaattgggacaccacccaatactacacctatcaaaaatggc
tctccagaaattaaactgaaaatcaccaaaacatacatgaatgggaaacctctctttgaa
tcttcaatttgtggtgacggtgctgctgatgtgtctcagtcagaagaaaacgaacaaaaa
tctgataataagactaggaggaacaggaagaggagcataaaatatgactctttactggag
cagggccttgtggaagcagctttagtgtccaagatctcaagtcctgcagataaaaagatt
ccagttaagaaggagtcctgtccaaatactggcagagacagagacctcttgttaaaatac
aacgttggtgatttggtgtggtccaaagtgtcaggttacccttggtggccttgcatggtt
tctgctgacccactccttcacaatcataccaaacttaaaggtcagaaaaaaagtgcacgc
cagtatcatgtacagttctttggtgatgccccagaaagagcttggatatttgagaagagc
cttgttgcttttgaaggagaagaacaatttgaaaaattatgccaagaaagtgccaagcag
gcacccacgaaagctgagaaaatcaagttgttgaaacctatttcggggagattgagagcc
cagtgggaaatgggcattgtccaagctgaggaagctgccagcatgtcaatagaggagcgg
aaagccaaatttaccttcctttatgtgggggaccaattgcacctcaaccctcaagtagct
aaggaggctggcattgttacagaacctttgggagaaatggtggactcttcaggggccagt
gaagaggctgctgtagaccctgggtctgtgagagaagaggatattcccacgaagagaagg
cgaagaaccaaaaggtctagttctgctgagaaccaagaaggtgatcctggcacagacaag
agtacacctccaaagatggcagaggctgaacctaagcgaggagtaggctctcctgctggg
aggaaaaagtccacaggctctgctcctcggagcaggaagggagactcagcagcccagttt
ttagtcttttgtcaaaaacacagagatgaggttgtagctgaacatccagatgcctcaggg
gaagagattgaagaattgcttgggtcccagtggagcatgctcaatgaaaagcagaaagca
cgatataatacaaagttttccctaatgatctctgcccagtctgaagaagactctggaaat
gggaatgggaaaaaaagaagccacacaaagagagcagatgaccctgcagaggatgtggat
gttgaagacgcgcccaggaaaagacttagagcagataagcacagtcttcggaagcagaga
gagacaatcaccgacaaaacggccagaacaagctcttacaaggctatagaggcagcctcc
tcactcaagagccaggcagcaacgaaaaatttgtctgatgcttgcaaaccactgaagaag
cgaaatcgggcttctgcaacagcgtcttcagcacttgggtttaacaaaagttcatctcct
tctgcatccttaactgagcatgaggtctcagacagcccaggagatgaaccatcagagtct
ccatatgaaagtgcagatgaaacacagactgaagcatccgtctcatctaaaaaatctgaa
agaggaatggctgccaaaaaggagtacgtgtgtcagctgtgtgagaagacaggcagtctc
ttactgtgtgagggcccctgttgtggagcattccacctagcctgccttggactttcccga
agaccggaaggaagattcacctgcaccgaatgtgcctcagggattcactcatgcttcgta
tgtaaagaaagcaagatggaggtgaaacgttgtgtggtaaatcagtgtggaaagttttac
catgaagcctgtgtaaaaaaataccctctcactgtgtttgagagccgaggcttccgctgt
cctctccatagctgtatgagctgccatgcctccaacccttcaaatccacggccatcaaaa
ggtaaaatgatgcgatgtgtccgatgccccgttgcctatcatggaggggatgcctgtctg
gcagcaggatgttcggtgattgcttctaacagcataatctgcacaggccacttcactgcc
cggaaggggaagcggcaccatacccatgtcaatgtgagctggtgctttgtgtgctccaaa
gggggaagccttctgtgctgtgaggcctgcccagcagcctttcaccccgattgtctaaac
atcgagatgcccgatggtagctggttctgcaacgattgccgggctggaaagaagctccac
tttcaagacatcatctgggtcaaacttggtaactacagatggtggccggcagaagtttgc
catcccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccct
gtatttttctttgggtctaaagattattactggacgcatcaggcacgagtgttcccatac
atggagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaag
aacgcattgcaagaagctgaagctcgttttaatgaagtcaaacttcagcgggaagcccga
gaaacacaggagagtgagagaaagcctccaccatacaagcatatcaaggtgaataaacct
tatggtaaagtccagatctacacagctgacatttctgaaatcccgaagtgcaactgtaag
cccacagatgagaacccctgtggctctgattcagagtgtctgaacaggatgctaatgttt
gagtgccacccgcaggtgtgtcctgcaggggaatactgccagaaccagtgtttcactaag
cgccagtaccctgagaccaagatcatcaagacagatggcaaagggtggggcctggttgcc
aaaagggacatcagaaaaggagaatttgttaatgagtatgttggtgagctgattgatgaa
gaggagtgtatggcaagaatcaaatatgcacatgagaatgacatcactcacttctacatg
ctcaccatagacaaggaccgcataattgatgctggccccaaagggaattattcacgattc
atgaaccatagctgccagcccaattgtgagaccctgaagtggacagtgaatggggacaca
cgggttggcctgtttgctgtgtgtgacattcctgcaggtacagagctgactttcaactat
aaccttgattgtttgggcaatgaaaagacagtctgtcggtgtggagcctccaactgtagt
gggttccttggagacagaccaaagacatcagcatccctttcatcagaggaaaagggtaaa
aaggccaagaagaaaaccagaaggcgcagagccaagggtgaaggaaaacggcagtcagag
gatgagtgcttccgctgtggtgatggtgggcagctggtgctgtgtgaccgcaagttctgt
accaaggcctaccacctatcctgcctcggtttgggcaagcggccctttgggaagtgggaa
tgtccttggcatcactgtgatgtatgtggcaaaccttctacctcattttgccacctctgc
cccaactcattctgtaaggaacaccaagatgggactgctttccgttccacccaggatggg
cagtcctactgctgtgagcatgacttgagggcagactcttcaagtagcaccaagactgag
aaaccctttccagaatcactgaagtcaaaaggaaagaggaagaaaaggcggtgctggcga
agggtcacagatggcaaatag

DBGET integrated database retrieval system