KEGG   Mus musculus (mouse): 107868Help
Entry
107868            CDS       T01002                                 

Gene name
Usp9y, Dffry, Fafl2
Definition
ubiquitin specific peptidase 9, Y chromosome
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     107868 (Usp9y)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   107868 (Usp9y)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
Y A1; Y
AA seq 2556 aa AA seqDB search
MTITTRGSPVGENESQGQTSDGQPQPSFQQNQISSSDSSNETSPTTPPYEQGQGDAPPQH
EEEDPSFPHTDLAKLEDMINRSRWVVPVLPKGELEVLLEASIDLTKKGLDVKSEACQRFF
RDVLTVSFSKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPFLELLAIALNP
HCKFHVYNGARPCESVSSSVQFPEDELFACSPDLHSPKGWLVDLINTFGTLNGFQILHDR
FTSGSALNVQTIAALIKPFGQCYEFLTQHTLRKYFIPVIEVVPQILQKLTNEELKKETKT
EVKNDTISMIIKFLKNLASRIPGQEETVKNLETFRLKMILRLLQISSFNGKMNALNEINK
VLSSVSYYTHGHGNSEEEWLTVERMTEWIQQNNILSIVLQDSLHQPQYVEKIEKILRFVI
KEKALTLQDLNNIWAAQAGKHEAIVKNVHDLLAKLAWNFSPEQLDHLFDCFKASWTNASK
KQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSCS
QDRDTQKIQWIDCFIEEFRTNNKWVIPALKQIKEICSLFGEAPQNLSQTHQSPRVFYRHD
LISQLQHNHALVTLVAENLAAYMNSIRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNFL
RFLLKDGQLWLCVSQAKQIWNCLAENAVYFSDREACFMWYSKLMGDEPDLHPDINKEFFE
SNVLQLDPSLLTENGMKCFERFFKTVNCREGKLMIKRKIYMMDDLDLIGLDYLWKVVIQS
NDDISSRAIDLLKEIYTSLGPKLQANQVVIHEDFIQSCFDRLKASYDTLCVLDSEKDNIF
SCARQEAIRMVRILTVLREYISEYDSDYHEERMILPMSRAFRGKHLSFTVRFPNQGKEVE
DLDILSHTNATIGSVRRCILNRMNVNVAHTKIELFIGGELVASEDDRKLVEQLNLKDKSL
ITAKFIQINSNMPSSPDSSSDSSAGPPGNHSHNNYRDVSNPEMEKCLPGVIMSLQPRYIS
FLWQVADLGSMLTVPTLRDGARILMKLMPPDSTTLEQLRALCSDHVNLGERRLGQSLHSL
FFGSSASQVLYLTEVVYTLLMPAGAPLADISSDFQYHFLKSGGLPLVLSMLIQNNFLPNT
DVETRRDAYFSALKIAKLLLTIVGYGHVQAIAEACQPVADGTDPKTPINQVTHDQAVVLQ
NALQSIPNPSSECMLRNVSVHLAQQISGLASRYIPDICVIRAIQKIIWAAGCGSLELVFS
PNEDITETYKMTTSTRSNLEVKDEQVCCEALEVMTLCFALIPTAMDSLNKEKAWQSFVID
LLLYCPSKTVRQLAQEQFFLICTRCCMGHRPLLFFITLLFTILGGAANEKGKHSDVYFTL
LRRLLTYAYNSNIQVPNVDVLLNDEIDWLKRVRDYIKNTGETNVEDPILEGHLGVTKELL
SFQSPEKKYHIGCKTGGANLVKELIDYFIFPASKAYLQYMRSGELPIKQAIPVCGSPATI
NAGFELLVALAFGCVRNLKQIVNCLTELFYIGTPVTTCEAVGEWEYLPPVGPRPPKGFVG
LKNAGATCYMNSVIQQLYMIPSIRNSILAIDSIWSDTDDDIFKGEKQDSENNVDPRDDVF
RYPHQFEDKPTLSKVEDRKEYNIAVLKHLQITFGHLAASQLQYYVPKGFWQQFRLWGEPV
NLREQHDALEFFNSLVDSLDEAFKALGYPTVLSKVLGGSFADQKICQGCPHRYECEESFT
TLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPSVLTIQLK
RFDYDWERECAIKFNDYFEFPRELDMEPYTVAGATKLEGDSVNPQTQLIKQNEQSESVIP
GSTKYRLVGVLVHSGQANGGHYYSYIIQRNGKDSKRSHWFKFDDGDVTECKMDDDEEMKN
QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDITDEDDEIITYISELTFTRPH
QIMSPAIERSVWKQNVQFLHNQMQFSLEYFQFIKKLLTCNAVYLSPAPGQDHLLPEAEDI
TMISIQLASRFLFTTGFHTKKIIRGPANDWYDALCILLRHSKNVRFWFVHNVLFNVSNRF
SEYLLECPSAEIRGTFAKLIVFIAHFSLQDGSSPSPFTSPFANPGPYSQIYDNLSLSDHL
LKAVLSLLRREVSEHGRHLQQYFNLFIMYASLGLAEKTQLLKLNVPATFMLVSLDEGPGP
PVKYQYAELSKLHSVVSQLIRCCSVSSRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVA
DILFMRTTYMKKVIEDCSNSEDTVKLLLFCCWENPQFSCSVLSELLWQVAHSHAYELQPY
LDLLLQIILFEDSWQAHRIHNALKGIPNDQDGLFDTIQHSKNHHQKRAYQCIKWMVTLFN
SCPVAYQILQGNGDLKNKWTWAMEWLGDELERKPYSGNPQYTYSNWSPPVQSNETANGYF
LEKSHSAKMKLTKACDLYPEEDPDDQDALDEHVSHAPQDRTFYLYSHRSHYQQNYVPEQP
FSGPASHHLNNPQKNDKPQETHESNEEISSCLIKDQ
NT seq 7671 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcacaactcgtggctctccagtaggagagaatgagagccagggtcagacttct
gatggacaacctcagccttctttccaacagaaccagatctcatcatctgattcttccaat
gagacttctccaacaactcctccatatgaacaaggccaaggtgatgctccaccacagcat
gaagaagaggatccttcatttcctcatactgacctggcaaagttagaagacatgatcaac
aggtcccgatgggtggttcctgttttgccaaagggagaattagaagtacttttagaagct
tctattgatcttactaaaaaaggtctggatgttaaaagtgaagcatgccagcgttttttt
cgcgatgttttaactgtgtctttttccaaaatccttatggatgaggctgtgagtggatgg
aagtttgaaattcataggtgtattattaacaatacccatcgcctggtggagctttgtgtg
gccaaattgtctcaggactggtttccatttctagaacttctagcaattgcattaaatcct
cattgcaaatttcatgtctataatggtgcacgtccatgtgaatcagtgtcctcaagtgtt
cagtttcctgaagatgaactctttgcctgttctccagacctacattcaccaaaaggttgg
ttagtggacctcattaacacatttggcacactaaatggtttccagattttgcatgatcgt
ttcactagtggatcagcattaaatgttcaaacaattgcagctcttattaagccgtttgga
cagtgctatgagtttctcactcaacatacattaagaaagtacttcattccagttatagaa
gtagttccacaaatattacaaaaattaactaatgaagaactgaaaaaagaaacaaagact
gaagtgaaaaatgataccatttcaatgattattaaatttctaaaaaatttagcttcaaga
attccaggacaagaggaaactgttaaaaatttagaaacttttaggttaaaaatgatactc
agattgctacagatttcttcttttaatggaaagatgaatgcactgaatgaaattaacaaa
gtgctttcaagtgtgtcatattatacgcatggacatggtaattctgaagaagagtggcta
accgttgagcgaatgacagagtggatacagcagaacaatatcttatccattgtcttgcaa
gatagcctacatcaaccacagtatgtggaaaaaatagagaagattcttcgttttgtaatt
aaagaaaaggctcttactttacaggatcttaataatatctgggcagcacaggctggaaaa
catgaagctattgtgaagaatgttcatgatttactagcaaaattggcttggaatttttct
cctgaacaacttgatcatctctttgattgctttaaggcaagctggacaaatgcaagtaaa
aaacaacgtgaaaaactacttgaattgatacgtcgtcttgcagaagatgataaagatggt
gtaatggcacacaaagtgttgaatcttctttggaatctagctcacagtgatgacgtgcct
gtagatatcatggatctggctctcagtgcccacataaaaatactggattatagttgttcc
caggatcgagatacacaaaaaatccagtggatagactgctttatagaagaatttcgaaca
aataataaatgggtcatccctgcattaaaacaaattaaagaaatttgtagtttgtttggt
gaagcacctcaaaatttaagtcaaactcatcaaagtccccgtgtattttatcgtcatgac
ttaatcagccaacttcagcataatcatgctttagttactttggtagcagaaaaccttgca
gcttacatgaacagcataagattgtatgctagagatcatgaagattatgacccacaaact
gtaagactaggaagtagatacagtcatgttcaagaagtccaagaacggcttaatttcctc
agattcttactgaaggatggtcaactctggctctgtgtttcccaggcaaaacaaatatgg
aactgtttagcagagaatgccgtttactttagtgatcgagaagcctgttttatgtggtat
tccaaattaatgggagatgaacctgacttacatcctgatattaataaggagtttttcgaa
agtaatgtgcttcagcttgatccttctctattaactgaaaatgggatgaaatgttttgaa
agatttttcaaaactgttaattgtcgagaagggaaactaatgataaaaagaaaaatctat
atgatggatgatttggacttaataggattagactacctttggaaggttgtgattcagagt
aatgatgatatttcaagcagagcaatagatcttcttaaagagatatacacaagccttggt
cccaaattgcaagctaatcaggtagtaattcatgaagactttattcaatcttgctttgat
cgcttgaaagcctcatatgatacattgtgtgttttggatagtgaaaaagacaatattttt
agctgtgcaagacaagaagccatccgaatggttcgcatattaacggtcttaagggaatac
ataagtgaatatgacagtgattatcatgaggaaaggatgattctacctatgtcaagagca
tttcgtggaaaacacttgtcttttacagtacgatttccaaaccagggcaaagaggttgag
gatttggacatattgtctcatacaaacgctaccattggttctgtgcgacgctgcattctc
aatcgtatgaatgtcaatgtagcccatacaaaaattgaactgtttataggtggagagtta
gtagcgtctgaagatgacagaaagctagttgaacagttaaatttgaaagataaatcacta
attactgctaaatttatacaaataaattccaacatgccttcaagtcctgatagctcatct
gattcgtcagctggacctcctggaaaccatagtcataataactacagagatgtttccaat
ccagaaatggaaaagtgtttacctggggtgataatgtcactgcagcccagatacatatct
ttcctttggcaagttgcagacttaggtagcatgttgactgtgccaactcttagagatgga
gcaagaatacttatgaaacttatgccaccagatagcacaactctagaacaattaagagct
ctatgttcagaccatgtaaatcttggagaaagacgacttggtcaatctcttcactcactt
ttctttggttcttctgcctcccaagtgctatatttaacagaggtagtttacaccttgtta
atgcctgctggtgcacctctggctgatatttcctctgactttcagtatcacttcttgaaa
agtggtggcttacctcttgtactaagtatgctgatacaaaataacttcttaccaaataca
gatgttgaaactcgtagagatgcttacttcagtgcccttaaaatagccaaactgttgtta
actatcgttggctatggccatgttcaggccatagcagaagcttgtcagcctgttgcagat
ggcacagatcctaaaacaccgattaaccaggttactcatgatcaagctgtggtgctacaa
aatgcccttcaaagcattcctaatccttcttctgagtgcatgcttagaaatgtatcagtt
catcttgctcaacaaatatcagggttggcctcaagatatatacctgatatttgtgttatt
agagctatacaaaaaatcatctgggcagcaggatgtggatcattagagctagtttttagt
ccaaatgaagatatcacagaaacttacaagatgaccaccagtacaaggagtaatctagaa
gtgaaagatgaacaagtttgctgtgaagccctggaagtgatgacattatgttttgcttta
attccaactgctatggattcactcaataaagaaaaggcctggcagtcatttgtcattgac
ttactattgtactgtcctagcaaaactgtacggcagttggcacaggagcagttcttttta
atatgtaccagatgttgcatgggacatagacctttgctgttcttcattactctactcttt
accattttggggggtgcagctaacgagaagggtaaacattcagatgtctacttcacactt
ttaaggcgtcttctcacttatgcttacaacagcaacattcaagttcccaatgttgatgtt
cttctcaatgacgaaattgattggcttaaaagggttagggattacattaaaaatacagga
gaaacaaatgtagaagacccaatcttagaaggccatctgggagtaacaaaagagttactg
tcttttcagtctcctgaaaaaaagtatcatattggttgtaaaacaggaggtgctaatctt
gttaaagaattaattgattatttcatctttcctgcatccaaagcttacctgcaatatatg
agaagtggggaattgccaatcaagcaagctattccagtctgtggttcaccagctacaatt
aatgctggttttgaactacttgtagctttggcttttggttgtgtaaggaatcttaaacag
atagtaaactgtttgactgaactgttttacataggcacaccagtaactacttgtgaagcc
gttggtgaatgggaatatttaccccctgttgggccccgcccaccaaaaggatttgtggga
ctgaaaaatgctggtgctacttgttatatgaactctgtgatccaacagctatacatgatt
ccttcaatcaggaacagtattcttgcaattgatagcatatggagtgatacagatgatgat
atattcaaaggtgaaaagcaggacagtgagaataatgttgatcccagagatgatgtattc
agatatcctcatcaatttgaagataaaccaacattaagtaaagtagaagatcggaaagag
tacaacattgctgttttaaaacaccttcagataacctttggacatttagctgcttctcaa
ctacaatactatgtgccaaaaggattttggcaacaattcaggctttggggtgaacctgtt
aatctccgtgagcaacatgatgcattagagttttttaattctttggtggatagtttagat
gaagcttttaaagctttaggatatccaactgtgcttagtaaagtccttggaggatccttt
gctgatcagaagatttgccaaggctgcccacataggtatgaatgtgaagaatcttttaca
acattaaatgtagacattagaaatcaccaaaatcttcttgattctttggagcagtatgtt
aaaggagatttattagagggtgcaaatgcatatcactgtgaaaaatgtgataaaaaggtt
gatacagtaaaacgcttattgattaaaaaactaccttctgttcttactatccaactgaaa
cgatttgactatgattgggaaagagaatgtgcaatcaaattcaatgattactttgaattt
ccaagagaattggatatggaaccttacacagtagcaggtgccacaaagctggaaggtgac
agtgtaaatccacagactcaattgattaaacagaatgagcagtctgaaagtgtcatacca
ggaagcacaaaatatcgacttgttggtgtgcttgtacacagtggtcaagcaaatggtgga
cattattattcttacatcattcaaagaaatggtaaagacagtaagagaagtcactggttc
aaatttgatgatggagatgtaacagaatgtaaaatggatgatgatgaagaaatgaaaaat
cagtgctttggtggagagtatatgggagaagtttttgatcatatgatgaagcgtatgtca
tacaggcgtcagaaaagatggtggaatgcttacattcttttttatgaacggatggatata
actgatgaagatgatgagataataacatatatatcagagctaacatttaccagacctcat
cagattatgtcaccagccattgagagaagtgtatggaaacagaatgtgcaattcctgcat
aaccaaatgcagtttagcttagaatattttcagtttattaaaaaactgcttacatgtaat
gctgtgtacttaagccctgctccaggacaagatcacttgctaccagaagcagaagatatc
acaatgatcagcattcagcttgcttctagattcctctttactactggatttcatactaag
aaaataatccgtggacctgccaatgactggtatgacgcactttgtattctcctccgtcac
agcaagaatgtacgtttttggtttgttcataatgtcctctttaatgtatcaaatcgtttc
tctgagtaccttctggaatgtccaagtgcagaaatcagaggtacatttgcaaagcttata
gtatttattgcacatttttctttgcaagatggatcttctccttcaccttttacatcacct
tttgcaaatccaggaccttatagtcagatctatgacaatttaagcttgagtgatcattta
ctaaaagcagtattaagtctcttgagaagggaagtttctgaacatgggcgacatttacaa
caatatttcaatttatttataatgtatgccagcttaggtttggcagaaaagacccagctt
ctaaaactgaatgttcctgcaacctttatgcttgtgtctttggatgaaggaccaggccct
ccagttaaatatcaatatgctgagttgagcaagttacattcagtagtgtctcagctgatc
agatgttgcagtgtctcatcaagaatgcagtcttctatcaatggtaacccccctcttcca
aatccatttggtgacccaaatttatcacaaccgataatgccaattcagcaaaatgtggct
gacattttatttatgagaaccacttacatgaagaaagttattgaagactgcagtaactca
gaggatacagtcaaattacttctcttctgctgctgggagaatccccagttttcatgttct
gttcttagcgaactgctatggcaggttgcacattcacatgcatatgaacttcaaccatat
ttggatctacttttgcaaattattctgtttgaggactcctggcaagctcacagaattcat
aatgcacttaaaggaattccaaatgatcaagatggactgtttgatacaatccagcactct
aaaaatcaccatcaaaaaagagcctatcaatgtataaaatggatggtaactctctttaac
agttgtcctgttgcctaccagatcttgcagggtaatggagaccttaaaaataagtggact
tgggctatggaatggcttggagatgaacttgaaagaaaaccatattctggcaatcctcaa
tacacttacagcaactggtctcctccagtacaaagcaatgaaacagcaaatggttatttt
ttagagaaatctcatagtgcaaaaatgaaacttacaaaagcttgtgatctgtatccagaa
gaggaccctgatgaccaagatgccctcgatgaacatgtgtcacatgcaccacaagataga
acattttatctttattcacacagatctcactatcaacagaattatgtacctgaacagccg
ttttcaggtccagcatcacatcacttgaataaccctcagaaaaatgataaaccacaagaa
actcatgaaagcaatgaagaaatatcttcatgtctaataaaagatcagtaa

DBGET integrated database retrieval system