KEGG   Mus musculus (mouse): 107939Help
Entry
107939            CDS       T01002                                 

Gene name
Pom121, 2610027A18Rik, C80273, mKIAA0618
Definition
nuclear pore membrane protein 121
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    107939 (Pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5
AA seq 1200 aa AA seqDB search
MSPAAAAADGGERRRPPLGGREGRSRARGYGGPAGAAALGLALLGLALYLVPAAAALAWL
AVGASAAWWGLSREPRGPRALSSFVRDARRHPRPALTASPPPAKSPVNGSLCEPRSPLGG
PDPAELLLMGSYLGKPGPPEPALRQDPRERPGRRPPARSPPPASAVQRVHHVYPALPTPL
LRPSRRPPHRDCGPLSSRFVITPRRRYPIQQAQYSLLGALPTVCWNGGHKKAVLSPRNSR
MVCSPVTVRIAPPDSKLFRSSMSEQILDTTLSSPSSNAPDPCAKETVLNALKEKKKRTVA
EEDQLHLDGQENKRRRHDSGGSGHSAFEPLVANGVPAAFVPKPGSLKRSLASQSSDDHLN
KRSRTSSVSSLASACTGGIPSSSRNAITSSYSSTRGISQLWKRSGPTSSPFSSPASSRSQ
TPERPAKKTREEEPCQQSSSSPPLVTDKESPGEKVTDTTTGKQQSSWTSPPTPGSSGQRK
RKIQLLPSRRGDQLTLPPPPELGYSITAEDLDMERKASLQWFNKVLEDKPDDASASATDG
PPSTSPPFTFTLPAVGPAASPASLPAPSSNPLLESLKKMQESPAPSSSEPAEAATVAAPS
PPKTPSLLAPLVSPLAGPLASTSSDSKPAATFLGLASASSITPLTDSKSSGVSQAEQSVS
TPASTASSPTPKPSMLFGMLSPPASSSSLATPAPACASPMFKPIFPATPKSESDSPLPSS
SSAATTASSSTAPPTAASTTPTFKPIFDKMEPFTAMPLSTPFSLKQTTATATTTATSAPL
FTGLGTATSTVASGTAASASKPVFGFGVTTAASTASSTMTSTSQSVLFGGAPPVTTSSSA
PALASIFQFGKPLAPAASAAGTSFSQPLASSTQTAASNSGFSGFGSTLTTSTSAPATTSQ
PTLTFSNTVTPTFNIPFSSSAKPALPTYPGANSQPTFGATDGATKPALAPSFGSSFTFGN
SVASAPSAAPAPATFGSAAQPAFGGLKAAASTFGAPASTQPAFGSTTSVFSFGSATTSGF
GAAATAATTTQTTNSGSSSSLFGSSAPSPFTFGGSAAPAGSGGFGLSATPGTSSTSGTFS
FGSGQSGTPGTTTSFGSLSQNTLGAPSQGSPFAFSVGSTPESKPVFGGTSTPTFGQSAPA
PGVGTTGSSLSFGASSTPAQGFVGVGPFGSAAPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggcggctgcggcggctgacggaggcgagcggcggcggcccccgttgggcgga
cgggaaggccggagccgggcccgcggctacggaggaccggcgggtgctgcggccctcggc
ctagcgctgctcggcctcgcgctctacctggtgcccgcggcggccgcgctggcctggctg
gccgtgggggcgagcgcggcctggtggggcctgagccgagaaccccgcggcccgagggcc
ctgtcgtccttcgtgcgcgacgcgcgccgtcacccgcggccagctctcaccgcttcaccg
cctccggccaagtcaccagtcaacggtagcctctgcgaaccccgcagcccgctgggaggc
cccgacccggctgagctcttactcatgggcagctacctgggcaagcccggcccgcccgag
cctgccctccggcaggacccaagggagaggccggggcgccgcccacccgcacgctccccg
cctccggcctcggcggtccagcgagtccaccacgtctaccccgcgctccccaccccgctt
ttgcgaccctcccggaggccgccccaccgagattgtgggcctttgtccagtcggtttgtt
ataacaccccgaagacgatatcccattcagcaagcccagtattccttgcttggggcactt
ccaaccgtctgctggaatggtggccataagaaggctgtgctgtctccacggaactccagg
atggtgtgcagcccagtgacagtgaggattgcccctccagacagcaagctattccgctca
tcaatgtcagagcagatactcgatacaacactgtcttcaccatcaagtaatgccccagat
ccttgtgcaaaggagactgtcctgaacgccctcaaggagaagaagaaaagaacagtggcg
gaggaagaccagctgcaccttgatggccaggaaaacaagagaaggcgccatgatagcggt
gggagcggacattcagcattcgagccccttgtggccaacggagtccctgctgcatttgtg
cctaagcctggctccctgaagagaagtctggcttcccagagctcagatgaccacttgaac
aaacggtctcgcacctcctctgtgagctccctggctagtgcgtgcacaggaggcatcccc
agttctagccgcaatgccatcaccagctcctacagctccacccgtggcatctcacagctg
tggaagaggagtggtcccacatcttctcccttctccagtccagcttcctcccgctcccag
acaccagagaggccagccaagaagacaagagaggaggagccatgtcagcagtccagttct
tcacctcccttggtgacagacaaggagtccccaggagaaaaggttacagatacaaccact
gggaagcagcagagctcatggacttccccacccacacctggcagctccgggcaacgcaaa
cgcaagatccagctgctgccctcccggcgaggggaccagctcaccttgcctccaccccca
gagcttggctattccatcactgctgaagacctggacatggagaggaaagcctcactgcaa
tggtttaacaaggtcttggaggacaagccagatgatgcttccgcctcagccactgatggc
cccccttccaccagccctcccttcacattcaccctgcccgctgtggggcctgctgcctcg
ccagcctccctcccggctcccagctctaacccactgttggagagcttgaagaagatgcag
gagtctccagccccatcatcctcggaacctgctgaggcagcaacagttgcagccccttca
cctccgaagacacccagcctcttggcccctcttgtctcaccactggcagggcccctagcc
agcacctcctcagactccaaacctgcagccaccttcctggggctggcttctgcttcgtct
ataaccccactcactgacagcaagtcctctggagtctctcaggctgagcagtctgtcagc
accccagcctccacagcctcctccccgaccccaaagcccagcatgctgtttgggatgctg
agtccacctgccagctcttcctcccttgccactccagctccggcttgtgcttctcccatg
tttaagcccatttttccagccacacctaaaagtgagagtgatagccccttaccaagtagc
tcctcagccgccactacagcttcatccagcaccgcccctcccacagcagccagcaccaca
cccacgttcaagcccatttttgacaagatggagccattcacagccatgcccctgtcaact
cccttctccctgaagcagacaactgctacagccaccactacagccacatcagctcctctc
tttactggcctgggcactgccacttccacggtggcctctggcaccgcagcttctgcctca
aagcctgtctttggctttggagtgaccactgcagcgagtactgccagcagtaccatgact
tccacttcccagtcagttctgttcgggggagccccccctgttactacttctagctctgcc
ccagctctggcctccatcttccagtttggcaagcctcttgccccagcagcatctgcagca
ggcacctcctttagccagccccttgccagctctacccagactgctgccagcaatagtggc
ttcagtggttttggcagcaccctcaccacctccacctcggcccctgccaccaccagtcag
cccacgctgaccttcagcaacactgtcacccccaccttcaacattccctttagctccagt
gccaagcctgcgctcccaacctaccctggagccaactcacagcccacatttggagccacc
gatggggccaccaagccagcacttgccccaagttttggcagctcgttcactttcggcaac
tctgtggcctcagccccatcggcagccccagcaccagccacctttggcagtgctgcacag
ccagctttcggagggttgaaagccgcagcctccaccttcggcgcccctgccagcactcag
ccagcttttggtagcaccacgtctgtgttctcctttgggtcagctaccacatctggcttt
ggtgctgctgccaccgctgctaccaccacacagaccaccaacagtgggagcagcagctct
ctgtttggcagctctgctccatccccattcacattcggtggctcagcagctcctgctggc
agtggaggctttggccttagtgctaccccaggcaccagctccacctctggaactttcagc
tttggatctggacagagtgggaccccgggcaccaccacctcctttggaagtctgagtcag
aacaccctgggcgcacccagccagggctcaccctttgccttcagtgtgggcagtacacct
gaaagcaagcctgtgtttggaggcacatctacacctactttcgggcagagtgcccctgcc
cccggcgtaggcaccacagggagcagcctctcatttggggcctcttcaacacctgcccaa
ggctttgttggagttggaccttttggatcagcagctccttcgttttccattggtgcggga
tccaagaccccaggggctcgacagcgacttcaggcccgaaggcagcacacccgcaagaag
tag

DBGET integrated database retrieval system