KEGG   Mus musculus (mouse): 107951Help
Entry
107951            CDS       T01002                                 

Gene name
Cdk9, PITALRE
Definition
(RefSeq) cyclin-dependent kinase 9 (CDC2-related kinase) (EC:2.7.11.23 2.7.11.22)
  KO
K02211  
cyclin-dependent kinase 9 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    107951 (Cdk9)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107951 (Cdk9)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     107951 (Cdk9)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   107951 (Cdk9)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     107951 (Cdk9)
    Brd4/P-TEFb complex
     107951 (Cdk9)
    7SK RNP complex
     107951 (Cdk9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 B
AA seq 372 aa AA seqDB search
MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDKYELFEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcagtacgactcggtggaatgcccgttctgcgatgaggtcaccaagtacgag
aaacttgccaagatcggccaaggcacattcggggaagtctttaaagccaagcaccgtcag
acgggccagaaggtggctctgaagaaagtgttgatggagaatgagaaggaggggttcccc
atcacagccttgagggaaatcaagattctacagctcctaaaacatgagaatgtggtgaac
ctaattgagatttgtcggaccaaagcctcaccgtataaccgctgcaagggcagcatctat
ctggtgtttgacttctgtgagcatgaccttgctgggctgctgagcaacgtcttagtcaag
ttcacgttgtctgagatcaagagagtgatgcagatgctgctgaacggcctctactacatc
cacaggaacaagatcctgcacagggacatgaaggctgcgaatgtgctcattacccgggat
ggggtcctgaagctggcagattttgggctggcccgtgccttcagcctagctaagaatagc
cagcccaaccgatacaccaaccgtgtggtgacattgtggtaccggcctccggagctgctg
ctcggagagcgggactacggcccgcccattgacctttggggtgctgggtgcatcatggca
gagatgtggactcgtagccctatcatgcagggtaacacagagcagcaccagctcgccctc
atcagccagctctgtggctccatcaccccagaggtgtggccaaacgtagacaagtatgag
ctgtttgaaaagctggaacttgtgaagggccagaagcggaaggtgaaggaccgtctgaag
gcctacgtgcgcgacccctatgctctggacctcattgacaagctgctggtgctggacccc
gcgcagcggattgacagtgacgatgccctcaaccacgacttcttctggtcggaccccatg
ccctcggacctcaagggcatgctgtctactcacttgacgtctatgtttgagtacctggca
ccgccacggcggaagggcagccagatcacccagcagtccaccaaccagagcagaaatccc
gccaccaccaaccagacggaatttgaacgtgtcttctga

DBGET integrated database retrieval system