KEGG   Mus musculus (mouse): 107975Help
Entry
107975            CDS       T01002                                 

Gene name
Pacs1, AI325977
Definition
(RefSeq) phosphofurin acidic cluster sorting protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 961 aa AA seqDB search
MAERGGAGGGPGGSGGGSSQRGSGVAQSPQQQPQQQPPQPQQPTPPKLAQATSSSSSTSA
AAASSSSSSTSTSMAVAVASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRLFS
LTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIILPASGLVETELQLTFSLQYPHF
LKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKDVS
VPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQDLF
YEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRFKVSDEVGFGLEHVSREQIREV
EEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLKPFFEGMSQSSSQTEIGSLNSKG
SLGKDTTSPMELAALEKVKSTWIKNQDDSLTETDTLEITDQDMFGDVSTSLVVPEKVKTP
MKSSKADLQGSASPSKVEGTHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQ
IPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAV
LSALLTRIQRYCNCNSSMPRPVKVAAVGSQSYLSSILRFFVKSLASKTPDWLGYMRFLII
PLGSHPVAKYLGSVDSRYSSTFLDSAWRDLFSRSEPPVSEPLDVVGRVMQYVNGATTTHQ
LPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPSTSP
PSSSGLSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRD
ASSKNTLKSVFRSVQVSRLPHAGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEVDS
KSQVIEGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGSKT
T
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgcggaggggcgggcggtggtcccggaggctccgggggcggcagcagtcag
cggggctctggggtcgcccagtccccgcagcagcagccgcagcagcagccgccgcagcct
caacagccgacgccccccaagctggcccaggccacctcgtcctcctcgtccacctcggct
gcggccgcctcctcctcgtcctcctccacctccacctccatggccgtcgcggtggcctcg
ggctctgcgcctccgggcggtccaggaccaggccgcacccccgccccagtgcagatgaat
ttgtatgctacctgggaggtggaccggagctcatccagctgcgtgcccaggctcttcagc
ttaactctgaagaaacttgttatgcttaaagaaatggacaaagatcttaactcagtagtc
attgctgtgaagctgcagggttcaaaaaggattcttcgctccaatgagatcatccttcca
gccagtggcctggtggagacagagctccagttaaccttctccctccagtaccctcatttc
cttaagcgagatgccaacaaactgcagattatgttgcaaaggaggaagcggtacaagaac
cgaactatcttgggctataaaaccttagctgtgggactcatcaacatggcagaggtgatg
caacaccctaatgagggcgctttagtacttggcctgcacagcaatgtgaaggatgtctct
gtgccagtggcagaaataaaaatctactctttatccagccagcccattgaccatgaagga
atcaagtctaagctgtctgatcgctccccagatattgacaactactctgaagaagaggag
gaaagcttctcctcagagcaggaaggcagtgacgacccattgcatgggcaggacctattc
tatgaagatgaagatcttcggaaagtaaagaagactcggaggaaactgacctcaacctca
gccatcactaggcaacctaacatcaaacagaagtttgtggccctcctgaaacgattcaaa
gtttctgacgaggtgggctttgggctagaacacgtgtcccgggagcagattcgggaagtg
gaggaggacttggatgaactgtacgacagtctagagatgtacaaccccagcgacagtggc
cctgagatggaggaaacagaaagcatcctcagcaccccaaagcccaagctcaagcccttc
tttgaggggatgtctcagtccagctcacagacggagattggcagtctcaacagcaagggc
agcctcgggaaagacaccaccagtcctatggagttggctgctttagaaaaagtcaaatct
acctggattaaaaaccaagatgacagcttgactgaaacagacactttagaaatcactgac
caggacatgtttggagatgtgagcacaagtctggttgtaccagaaaaagtcaaaactcct
atgaagtccagcaaagctgatctgcagggctctgcctctcccagcaaggtggaagggaca
cacacacctcggcagaagaggagcactcccctgaaggagcgacagctctccaagcccctg
agtgagagaaccaacagctctgacagtgagcgatctcctgatctgggccacagcacacag
attccaaggaaggtggtatacgaccaactgaatcagatcctggtatcggatgcagccctc
cctgaaaatgtcatcctggtgaacaccacagactggcagggccagtacgtggctgaattg
cttcaagaccagaggaagcctgtggtatgcacctgctcaacagtggaggtccaggcagtg
ctgtccgcccttctcactaggattcagcgctactgcaactgcaactcatccatgccgagg
ccggtcaaggtggcagctgtgggcagccagagctacctgagctccatcctccgttttttt
gtcaagtcccttgccagcaagaccccagactggctgggttacatgcgcttcctcatcatt
cccctaggttctcatccagtggccaaatacttgggctcagtagatagtagatatagcagc
acctttcttgattctgcctggagagacctattcagtcgctcagagcctccagtgtcagag
ccactggacgtggtgggtcgtgtgatgcagtatgtcaatggagctaccacaacacaccag
ctgcctgtggctgaagccatgttgacctgcaggcataagttccctgatgaggactcctac
cagaagttcatccccttcattggcgttgtgaaagtgggccttgttgaagactcgccctcc
actgcaggtgatggggacgattcacctgtggtcagccttactgtgccctccacatcacca
ccctcaagctcaggcctgagccgagatgccacagctacccctccctcgtccccatccatg
agcagtgccctcgccatcgtggggagcccaaatagcccatatggggatgtgattggtctc
caggtggactactggctgggccaccctggggagcgaaggagagaaggtgataagagggat
gccagctcaaagaacaccctcaagagtgtcttccgctcggtgcaggtttctcgcctgcca
catgcaggggaagcccagctttctggcaccatggcaatgactgtggtcaccaaagagaag
aacaagaaagtgcccactatcttcctgagcaagaagccccgagaaaaggaggtggattct
aagagccaggtcatcgagggcatcagccgcctcatctgttctgcaaagcagcagcaaacc
atgctgagagtgtccatcgatggagttgagtggagtgacatcaagttcttccagctggca
gcccagtggccaactcatgtcaagcactttccagtgggactcttcagtggcagcaagacc
acctga

DBGET integrated database retrieval system