KEGG   Mus musculus (mouse): 108068Help
Entry
108068            CDS       T01002                                 

Gene name
Grm2, 4930441L02Rik, Gprc1b, mGluR2, mGluR7
Definition
(RefSeq) glutamate receptor, metabotropic 2
  KO
K04605  
metabotropic glutamate receptor 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    108068 (Grm2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108068 (Grm2)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    108068 (Grm2)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    108068 (Grm2)
G protein-coupled receptors [BR:mmu04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    108068 (Grm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 F1
AA seq 872 aa AA seqDB search
MESLLRFLALLLLRGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGGPAEECGPVNEHRGIQ
RLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRGADGSRHI
CPDGSYATLSDAPTAITGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDY
FARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEK
VGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAATQRLNASFTWVASDGWGAL
ESVVAGSERAAEGAITIELASYPISDFASYFQNLDPWNNSRNPWFREFWEERFRCSFRQR
DCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALCPNTTRLCDAMRPVNGRRLYK
DFVLNVKFDAPFRPADTDDEVRFDRFGDGIGRYNIFTYLRAGNGRYRYQKVGYWAEGLTL
DTSIIPWASPSAGTLPASRCSEPCLQNEVKSVQPGEVCCWLCIPCQPYEYRLDEFTCADC
GLGYWPNASLTGCFELPQEYIRWGDAWAVGPVTIACLGALATLFVLGVFVRHNATPVVKA
SGRELCYILLGGVFLCYCMTFIFIAKPSTAVCTLRRLGLGTAFSVCYSALLTKTNRIARI
FGGAREGAQRPRFISPASQVAICLALISGQLLIVAAWLVVEAPGIGKETAPERREVVTLR
CNHRDASMLGSLAYNVLLIALCTLYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIF
YVTSSDYRVQTTTMCVSVSLSGSVVLGCLFAPKLHIILFQPQKNVVSHRAPTSRFGSAAP
RASANLGQGSGSQLVPTVCNGREVVDSTTSSL
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgcttaggttcctggcactgctgctgctgcggggtgctgtggccgagggc
ccggccaagaaggtgctgaccctggagggggacctggtgctgggtgggctgttcccagtg
caccagaagggtggcccagcagaggagtgtggacctgttaatgagcaccgtggcatacag
cgcctagaggccatgctttttgcactggaccgcatcaaccgcgacccccatctgctgcct
ggggtgcgtttgggcgcgcacatcctcgacagctgctccaaggatacacacgccctggag
caggccctggactttgtgcgtgcctcactcagccgtggggctgatggctcacgccacatc
tgtcctgacggctcctatgctactctcagtgatgctcccacagctatcaccggtgtcatt
ggcggctcctacagtgatgtctccatccaggtggccaatctcctgcggctgttccagatc
ccacagatcagctatgcctccaccagcgccaagctgagcgacaagtcccgttatgattac
tttgctcgcaccgtgcccccagacttcttccaagccaaggccatggctgagattctccgc
tttttcaactggacgtatgtgtctacggtggcatctgagggtgactatggagagacaggc
attgaggccttcgagctcgaggctcgggcacgcaacatctgcgtggccacttcggagaag
gtgggccgtgccatgagccgcgcagccttcgagggtgtggtgcgagccctgttgcagaag
cccagcgcccgtgtggctgtgctcttcacccggtcagaggatgcccgtgagctgcttgca
gccacccagcgtctcaacgccagcttcacctgggtagccagcgacggctggggggcccta
gagagcgtggtggcaggcagtgaaagggctgccgagggcgccatcaccattgagctggcc
tcctaccccatcagtgactttgcctcctacttccagaacttggatccctggaacaacagc
aggaacccttggttccgtgagttctgggaggagaggttccgttgcagcttccggcagcga
gactgcgccgcccactctctgcgggccgtaccctttgaacaggagtcaaagatcatgttt
gtggtcaatgccgtgtatgccatggcccacgctctgcacaacatgcaccgtgccctctgt
cccaacaccacccgcctctgcgatgccatgagacctgtcaatgggcgccgcctctacaag
gacttcgtgctcaatgtcaagtttgatgcccccttccgcccagcagataccgacgacgag
gtccgctttgaccgctttggagatggtattggccgctacaacatcttcacctatctgcgg
gcaggcaatgggcgctatcgctaccagaaggtaggctactgggcagaaggtctgactctg
gatactagcatcatcccatgggcctccccatcagctggcaccctccctgcctctcgctgt
agcgagccctgccttcagaatgaggtgaagagcgtgcagcccggcgaggtctgctgctgg
ctctgcatcccctgtcagccctatgagtacaggctggatgagttcacctgtgctgactgt
ggcctgggctactggcctaatgccagtctgactggatgctttgagctgccccaggagtac
atccgctggggcgacgcctgggcggtgggacctgtcaccatcgcctgcctaggtgccctg
gccaccctctttgtgttgggtgtcttcgtgcggcataacgccacacccgtggtcaaggcc
tcggggcgggagctttgctacattctgctgggaggcgtcttcctctgctactgcatgacc
ttcatcttcatcgccaagccctccacggccgtctgcaccttaaggcgcctcgggttgggg
accgccttctctgtctgctactcagccctcctcaccaagaccaatcgcatcgctcgcatc
tttggcggggcccgggagggtgcccagcggccgcgcttcatcagtcccgcctcacaggtg
gccatctgcctggcacttatctcgggccagctgctcattgttgctgcctggctggtggtg
gaggcacctggcataggcaaggagacagcccctgagcggcgggaagtggtgaccttgcgc
tgtaaccaccgtgacgcaagcatgcttggctcgctggcctacaacgtgctcctcatcgct
ctctgcacgctctatgccttcaagacccgcaagtgcccggagaacttcaacgaggccaag
ttcatcggctttaccatgtacaccacctgtatcatctggctggctttccttcccatcttc
tacgtcacctccagtgattatcgggtgcagaccactacgatgtgcgtgtccgtcagcctc
agtggctctgtggtgctcggctgcctctttgcacccaagctgcacattatcctcttccag
ccacagaagaacgtggtgagccaccgggcacctaccagccgctttggcagtgctgccccc
agggccagcgccaaccttggtcaagggtctggatcccagcttgttcctactgtttgcaat
ggccgtgaggtggtagactcaacaacatcgtcgctttga

DBGET integrated database retrieval system