KEGG   Mus musculus (mouse): 108097Help
Entry
108097            CDS       T01002                                 

Gene name
Prkab2, 5730553K21Rik, AW049591, BB124140
Definition
(RefSeq) protein kinase, AMP-activated, beta 2 non-catalytic subunit
  KO
K07199  
5'-AMP-activated protein kinase, regulatory beta subunit
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    108097 (Prkab2)
   04152 AMPK signaling pathway
    108097 (Prkab2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108097 (Prkab2)
   04922 Glucagon signaling pathway
    108097 (Prkab2)
   04920 Adipocytokine signaling pathway
    108097 (Prkab2)
   04921 Oxytocin signaling pathway
    108097 (Prkab2)
  Aging
   04211 Longevity regulating pathway - mammal
    108097 (Prkab2)
   04213 Longevity regulating pathway - multiple species
    108097 (Prkab2)
  Environmental adaptation
   04710 Circadian rhythm
    108097 (Prkab2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    108097 (Prkab2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108097 (Prkab2)
   04931 Insulin resistance
    108097 (Prkab2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2.2
AA seq 271 aa AA seqDB search
MGNTTSERVSGERHGAKAARAEGGGHGPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVP
WQQDLDDSVKPAQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDL
SSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHL
YALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacactaccagcgagcgggtgtccggggagcgccacggagccaaagctgctcga
gctgagggcggcggccatggcccgggaaaggagcacaagatcatggtggggagcacggac
gaccccagcgtcttcagcctgcccgactccaagctccccggggacaaagagtttgtaccc
tggcagcaggatttggatgattctgtgaagcccgcccagcaggcccggcccaccgttatc
cgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagcacc
aagatccctctgataaagagtcataatgacttcgttgccatcctggatcttccagaggga
gagcatcagtacaagttctttgtggacggacagtgggttcatgatccgtcagagcctgtg
gttaccagtcagcttggaacaattaataacttgatccacgtcaagaaatctgattttgaa
gtatttgacgctttaaagttagactctatggaaagctcggagacgtcatgtcgagacctg
tccagctcaccccctgggccttacggtcaagaaatgtatgtgtttcgatctgaggagaga
ttcaaatccccacccatcctgccccctcacctactccaagttattcttaacaaggacacg
aatatttcatgtgacccagccttacttcctgagcccaatcatgttatgctgaaccatctc
tatgcactgtccattaaggacagtgtgatggtccttagcgcaacccatcgctacaagaag
aagtatgtcaccacgctgctgtataagcccatctga

DBGET integrated database retrieval system