KEGG   Mus musculus (mouse): 108124Help
Entry
108124            CDS       T01002                                 

Gene name
Napa, 1500039N14Rik, AW209189, RA81, SNAPA, SNARE, a-SNAP, hyh
Definition
(RefSeq) N-ethylmaleimide sensitive fusion protein attachment protein alpha
  KO
K15296  
alpha-soluble NSF attachment protein
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    108124 (Napa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A2; 7 8.74 cM
AA seq 295 aa AA seqDB search
MDNSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQK
AIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTEAVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacaactccgggaagcaggctgaggctatggcgctgctggctgaagcggagcgcaag
gtgaagaactcgcagtccttcttctccggcctctttggaggctcatccaaaatagaggaa
gcatgcgagatctatgccagagcggcgaacatgttcaagatggccaagaactggagcgct
gctgggaacgctttctgccaggctgcccaactacacctacagctccaaagcaagcacgat
gcagccacctgctttgtggacgctggcaatgctttcaagaaagctgacccccaagaggcc
attaactgtctgatgagagcaattgagatctatacagacatgggcagattcacaatcgca
gccaagcaccacatctccatcgctgagatctatgagacagaactggtggatgtagagaag
gccatcgcccactatgagcaatctgcagactactacaaaggagaagagtccaacagctca
gccaacaagtgtctgctgaaggtggctggctacgccgcacagctggagcagtaccagaag
gctatcgacatctatgagcaggtggggaccagtgccatggacagtcccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctctgccacttctgcattgacatgctcaac
gccaagctcgctgttcagaagtatgaggagctcttcccggccttctcggattcccgggaa
tgcaagctgatgaaaaagctgctggaagcccatgaggaacagaatgtggacagctacaca
gaggcggtgaaggaatatgactccatctccagactggaccagtggcttaccaccatgctt
ctgcgcataaagaagaccattcagggtgacgaggaggacctgcgctag

DBGET integrated database retrieval system