KEGG   Mus musculus (mouse): 108124Help
Entry
108124            CDS       T01002                                 

Gene name
Napa, 1500039N14Rik, AW209189, RA81, SNAP-alpha, SNAPA, SNARE, a-SNAP, hyh
Definition
(RefSeq) N-ethylmaleimide sensitive fusion protein attachment protein alpha
  KO
K15296  alpha-soluble NSF attachment protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    108124 (Napa)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    108124 (Napa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP TPR_12 TPR_7 Spatacsin_C
Motif
Other DBs
NCBI-GeneID: 108124
NCBI-ProteinID: NP_080174
MGI: 104563
Ensembl: ENSMUSG00000006024
Vega: OTTMUSG00000023922
UniProt: Q9DB05
Position
7 A2; 7 8.74 cM
AA seq 295 aa AA seqDB search
MDNSGKQAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDVEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAAQLEQYQK
AIDIYEQVGTSAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTEAVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacaactccgggaagcaggctgaggctatggcgctgctggctgaagcggagcgcaag
gtgaagaactcgcagtccttcttctccggcctctttggaggctcatccaaaatagaggaa
gcatgcgagatctatgccagagcggcgaacatgttcaagatggccaagaactggagcgct
gctgggaacgctttctgccaggctgcccaactacacctacagctccaaagcaagcacgat
gcagccacctgctttgtggacgctggcaatgctttcaagaaagctgacccccaagaggcc
attaactgtctgatgagagcaattgagatctatacagacatgggcagattcacaatcgca
gccaagcaccacatctccatcgctgagatctatgagacagaactggtggatgtagagaag
gccatcgcccactatgagcaatctgcagactactacaaaggagaagagtccaacagctca
gccaacaagtgtctgctgaaggtggctggctacgccgcacagctggagcagtaccagaag
gctatcgacatctatgagcaggtggggaccagtgccatggacagtcccctcctcaagtac
agcgccaaagactacttcttcaaggcggccctctgccacttctgcattgacatgctcaac
gccaagctcgctgttcagaagtatgaggagctcttcccggccttctcggattcccgggaa
tgcaagctgatgaaaaagctgctggaagcccatgaggaacagaatgtggacagctacaca
gaggcggtgaaggaatatgactccatctccagactggaccagtggcttaccaccatgctt
ctgcgcataaagaagaccattcagggtgacgaggaggacctgcgctag

DBGET integrated database retrieval system