KEGG   Mus musculus (mouse): 108138Help
Entry
108138            CDS       T01002                                 

Gene name
Xrcc4, 2310057B22Rik, AW413319, AW545101
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
mmu  Mus musculus (mouse)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    108138 (Xrcc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 C3; 13
AA seq 326 aa AA seqDB search
MERKVSRIYLASEPNVPYFLQVSWERTIGSGFVITLTDGHSAWTATVSELEISQEADDMA
MEKGKYIDELRKALVPGSGAAGTYKFLFSKESRHFSLEKELKDVSFRLGSFNLDKVSNSA
EVIRDLICYCLDTITEKQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALEADLYQRF
ILVLNEKKTKIRSLHKLLNEVQQLEESTKPERENPCSDKTPEEHGLYDGSTDEESGAPVQ
AAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKMAPQELPLQEKERLASSLPQT
LKEESTSAENMSLETLRNSSPEDLFD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggaaagtaagcagaatctatcttgcttctgaacccaacgtaccttattttctg
caagtgtcttgggagagaacaataggatccggctttgttattacacttactgacggccat
tcagcctggactgcaacagtttctgaattggagatttcccaagaagctgatgacatggct
atggagaaaggaaaatacattgatgagctgagaaaggcactggtgccagggtcaggagca
gctggtacatacaagttcctcttttctaaggagtctcggcatttctcccttgagaaagaa
ctgaaagatgtttcattcagacttggttccttcaacctagacaaagtttcaaactcagct
gaagtcataagagatctcatttgttactgcctggacaccattacagaaaagcaagccaaa
aacgagcacctgcagaaagaaaatgaaaggctcctgagagactggaatgatgttcaaggc
cgatttgagaaatgtgtgagtgccaaagaagccttggaggctgatttgtatcaaagattt
atcttggtgctgaatgagaagaaaacaaagatccggagcttgcataaattgctaaatgaa
gtccagcagctggaggagagtaccaaacctgaaagggaaaatccgtgttctgacaaaaca
cctgaggagcatgggctttatgatggaagcaccgatgaagaaagtggagcccctgtgcag
gctgcagaaactcttcataaggatgattccatattttcaagtccggatgtcactgacatt
gcaccaagtaggaagaggagacaccgaatgcagaagaatcttgggacagaacctaaaatg
gctccacaggagttgccgctacaggagaaggaaaggcttgcctcttcactaccccagacc
ttgaaagaggagagcacctctgctgaaaacatgtctttagaaaccctgagaaacagcagc
ccagaagatctctttgattag

DBGET integrated database retrieval system