KEGG   Mus musculus (mouse): 108143Help
Entry
108143            CDS       T01002                                 

Gene name
Taf9, 2310012M09Rik, AA673500, AU045423, TAFII31, TAFII32, Taf2g
Definition
TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor (EC:2.7.4.3)
Orthology
K14535  
transcription initiation factor TFIID subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    108143 (Taf9)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     108143 (Taf9)
   Coactivators
    SAGA/TFTC/STAGA complex
     108143 (Taf9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 D1; 13
AA seq 264 aa AA seqDB search
MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKAPAPAGRITVPRLSVGSVSSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPASQSPAVKASIPATSTVQNVLINPSLIGSKNILITTNMVSQNTAESAN
ALKRKREDDDDDDDDDDDDDYDNM
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggagtctggcaagatggcgtctcccaagagcatgccgaaagatgcacagatgatggca
caaatcctgaaggatatggggattacagaatatgagccaagagttataaatcagatgctg
gagtttgccttccgatatgtgacaacaattctagatgatgctaaaatttattccagccat
gctaagaaagctactgttgatgcagatgacgtacgactggcaatccagtgccgtgctgac
cagtctttcacttctccacccccgagagatttcttattagatattgcacgacaaagaaat
caaacccctttgccactgatcaagccatattcaggtcctagattgccacctgataggtat
tgcttaactgccccaaactataggcttaagtctttacagaaaaaggcacctgctcctgca
ggaagaataacagttccaaggttaagtgttggttcagtttctagtagaccaagtactccc
accctaggtacaccgactccacaaaccatgtctgtttcaactaaagtaggcaccccaatg
tccctcacaggacagaggtttacagtacagatgcctgcttctcagtcccctgctgtaaaa
gcttctatacctgcaacatcaacagttcagaatgttcttattaatccatcgttaattggg
tccaaaaacattcttattactactaatatggtatcacagaatacagccgagtcagcaaat
gcactgaaacggaaacgtgaagacgatgatgatgacgatgatgacgatgatgatgatgac
tatgataatatgtag

DBGET integrated database retrieval system