KEGG   Mus musculus (mouse): 108682Help
Entry
108682            CDS       T01002                                 

Gene name
Gpt2, 4631422C05Rik, ALT2, AU014768, AU041193, C87201
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2 (EC:2.6.1.2)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    108682 (Gpt2)
   01210 2-Oxocarboxylic acid metabolism
    108682 (Gpt2)
   01230 Biosynthesis of amino acids
    108682 (Gpt2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108682 (Gpt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     108682 (Gpt2)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class I
   108682 (Gpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C3; 8
AA seq 522 aa AA seqDB search
MQRAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPERSPRDRILTLESMNPQVKAV
EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPN
LLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNI
YLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCW
ALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEV
YQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHP
EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTE
DLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPG
SGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQYS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcagcggtgctggtgcggcggggctcctgcccccgcgcctcgggcccctgg
ggccgtagtcacagcagcgctgcagccgaagcctcggcggcgctcaaggtgcgaccggag
cgcagccctcgagaccgcatcctcaccctggagtccatgaacccgcaggtgaaggcggtg
gagtacgctgtgcggggacccatcgtgctcaaagccggcgagatcgagatggagctgcag
cggggtatcaaaaaaccattcactgaggtaatccgagccaacattggggatgcccatgct
atgggccagcagccaatcaccttcctccgtcaggtgatggcactctgcacctacccaaac
ctactaaacagccccagcttcccagaagacgctaagaaacgagcgcggcggatcctgcag
gcttgtggtggaaacagcttgggatcttacagtgctagccaaggcgttaactgtatccgt
gaagatgtggcagcctttatcaccaggagagatggtgtgcctgcagacccagacaacatt
tacctgactactggagctagcgacggtatttctacaatcctgaagctcctggtctccggt
ggtggcaagtcacggaccggcgtgatgattcccatcccccagtatcccttgtactccgcg
gtcatctctgagctcgacgcggtgcaggtcaactactatctggatgaagagaactgctgg
gctttgaatgtggacgagctccggcgggcattgcggcaagccaaagaccactgtgaccct
aaagttctctgcattatcaaccccggaaaccccacaggccaggtacaaagcagaaagtgc
atagaagatgtgattcactttgcctgggaagagaagctttttctcctggctgatgaggtg
taccaggacaacgtgtactctccagactgcagattccactcgtttaagaaagtgctttac
cagatggggcacgagtactccagcaacgtggagctcgcctccttccactccacctccaag
ggctacatgggcgagtgtggctacagagggggctacatggaggtgatcaatttgcacccc
gagatcaaaggccagctggtgaagctactctcggttcgcctctgtccgccagtgtcagga
caggccgccatggacattgttgtgaatccaccggaaccaggagaggagtcctttgagcaa
ttcagcagggaaaaagaattcgtccttggtaatctggccaaaaaagcaaagctgacagaa
gatctgtttaaccaagtcccagggatccagtgcaaccccttgcaaggagctatgtatgcg
ttccctcggattctcatccctgccaaggccgtggaggcagctcagtcccataaaatggct
ccagacatgttctactgcatgaagctcctggaggagactggcatctgtgtcgtgcctggc
agtggctttgggcagcgagaaggcacttaccacttcagaatgaccattctccctccggtg
gataaactgaagaccgtgctccacaaggtgaaagactttcacctgaagttcctggagcag
tactcatga

DBGET integrated database retrieval system