KEGG   Mus musculus (mouse): 109205Help
Entry
109205            CDS       T01002                                 

Gene name
Sobp, 2900009C16Rik, 5330439J01Rik, JXC1, jc
Definition
(RefSeq) sine oculis-binding protein homolog (Drosophila)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 B2; 10 22.89 cM
AA seq 864 aa AA seqDB search
MAEMEKEGRPPENKRSRKPAHPVKREINEEMKNFAENTMNELLGWYGYDKVELKDGEDIE
FRSYTTDGESRQHISVLKENSLPKPKLPEDSVISSYNISTGYSGLATGNGLSDSPAGSKD
HGNVPIIVPLIPPPFIKPPAEDDVSNVQIMCAWCQKVGIKRYSLSMGSEVKSFCSEKCFA
ACRRAYFKRNKARDEDGRAETFPQQHYAKETPRLAFKNNCELLVCDWCKHIRHTKEYLDF
GDGERRLQFCSAKCLNQYKMDIFYKETQANLPAGLCSTLHPHMESKAEGTGVQLLTPDSW
NIPLTDARRKAPSPVTAAGQSQGPGPSSSTTVSPSDTANCSVTKIPTPVPKSLPISETPS
IPPVSVQPPASIGPPLGVPPRSPPMVMTNRGPVPLPIFMEQQIIQQIRPPFIRGPPHHAS
NPNSPLSNPMLPGIGAPPGGPRNLGPTSSPMHRPMLSPHIHPPSTPTMPGNPPGLLPPPP
PGAPLPSLPFPPVSMMPNGPMPVPQMMNFGLPSLAPLVPPPTLLVPYPVIVPLPVPIPIP
IPIPHVNDSKPPNGFSSNGESFVPSAPGDSSAAGGKAGGRSLSPRDSKQGSSKSADSPPG
SSGQALSLAPAERGRGEVVDLTRRAGSPAGAGGQPGFAGVLHGPQDGVIDLTVGHRARLH
NVIHRALHAHVKAEREPGAAERRTCGGCRDGHCSPPAAGDPGPGAPAGPEAAAACNVIVN
GTRSAPAEAKGAEPPPEQPPPPAPPKKLLSSEEPVVNELESVKENNCASNCHLDGEATKK
LMGEEALAGGDKSDPNLNNPADEDHAYALRMLPKTGCVIQPVPKPAEKAAMTPCVISSPM
LSAGPEDLEPPLKRRCLRIRNQNK
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatggagaaagaagggagacctccggaaaataaaagaagccggaaacccgct
caccctgtgaagagggagatcaacgaggagatgaagaactttgcagaaaacaccatgaat
gaactccttggctggtatggctatgataaagttgaattaaaagacggtgaagatattgaa
ttcagaagctacactacggatggagaaagccggcaacacatttctgttctcaaagaaaat
tctttgccaaaaccaaaattaccggaggacagtgttatttcatcttacaatataagcaca
ggctactcaggccttgccactgggaatggactcagtgactcacctgctgggtcaaaggac
catggcaatgtgcctattattgtccctttaatcccaccacctttcataaagccgccagca
gaagatgatgtgtcaaatgtacaaataatgtgtgcctggtgccagaaagtggggatcaag
cgctattccctgagtatgggaagcgaggtgaaaagcttctgcagcgagaaatgctttgcg
gcctgccggagagcctacttcaaaagaaacaaggctagagatgaagatggacgtgctgaa
acgtttccccagcagcactatgctaaggaaactccaaggcttgccttcaagaataactgc
gaactacttgtgtgtgactggtgtaaacacataaggcacacaaaagaatacctggatttt
ggggacggggagagaaggcttcagttctgcagtgcaaaatgtctcaatcaatacaaaatg
gacattttctacaaagagacacaggccaatcttccagccgggctgtgcagcacactccac
cctcacatggaaagtaaagcagaaggcaccggggtgcagctgctcacgccagactcttgg
aatatcccgctaacagatgctcggaggaaagccccttcccccgtgactgcagctggccaa
agccagggccccggcccatcctcgtccaccaccgtttctccatctgacactgccaactgc
tctgtcactaaaatccccacgccagtgcccaagtccctccccatcagcgagactccgagc
atccctcccgtctcggtccagccacctgctagcatcggacctccactgggtgtcccgcct
cgcagccctcccatggtgatgaccaaccgcggcccagtgcccctgcccatcttcatggag
cagcaaattatccagcagatccgcccgcccttcatccgcggaccaccgcaccacgcctcc
aaccccaatagtcccttgtccaaccccatgctcccgggcattggggccccgcccggaggc
cccaggaacctaggccccacttccagccccatgcaccggcccatgctatcgccccacatc
caccccccaagtacccctaccatgcctgggaaccccccagggctgctgcccccgccgccc
ccgggcgcgcccttgcccagccttcccttccctccggttagcatgatgccaaacggcccg
atgccggttccccagatgatgaacttcgggctgccttcgctggccccgctggtgccgccc
cccacgctgctcgtgccgtacccagtgatagtgcccctgccggtgcccatccctatccct
atccccattccccatgtgaacgattccaagccccccaacggattttccagcaacggggag
agcttcgttccgagcgctccgggcgactcatcggcggcgggaggcaaggctggtggacgc
tccctgtccccgcgggactccaagcagggctcttccaagtcagccgactcgccacccgga
agctccggccaggctctgagcctggcgcccgcggagcgcggtcgtggggaggtggtggac
ctgacccggcgcgcaggcagccccgcgggtgcgggaggccagccgggcttcgcgggcgtg
ttgcacggcccgcaggacggcgtcatcgacctgaccgtgggccaccgagcccggctgcac
aacgtgatacaccgtgcgctgcacgctcacgtcaaggcggagcgcgagccgggagccgcg
gagcgcaggacctgcggcggctgcagggacggccactgcagcccgcccgccgccggcgac
cccggcccgggcgcccccgcgggccccgaggccgctgccgcctgcaacgtcatcgtgaac
ggcacccgcagcgccccggccgaggccaagggcgcggagcccccgccggagcagccgccg
cccccagcccctcccaaaaagctactgtcgtccgaggagcctgtggtgaacgagctggag
tcggtcaaggagaacaactgcgcttccaactgccacctggacggggaagcgaccaaaaaa
ctgatgggggaggaagccctggcggggggcgacaagtcggacccgaacctcaataacccc
gcggacgaggaccacgcctatgctctgcggatgctgcccaagaccggctgcgtgatccag
cctgtgccaaaacccgcggagaaggctgccatgacgccgtgcgtcatctcctcgcccatg
ctcagcgctggccctgaggacctggagcctccgctcaaaaggaggtgcctccgaattaga
aaccagaataagtaa

DBGET integrated database retrieval system