KEGG   Mus musculus (mouse): 109305Help
Entry
109305            CDS       T01002                                 

Gene name
Orai1, D730049H07Rik, Tmem142a, orai-1
Definition
(RefSeq) ORAI calcium release-activated calcium modulator 1
  KO
K16056  
calcium release-activated calcium channel protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Platelet activation
Renin secretion
Aldosterone synthesis and secretion
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    109305 (Orai1)
   04024 cAMP signaling pathway
    109305 (Orai1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    109305 (Orai1)
  Endocrine system
   04924 Renin secretion
    109305 (Orai1)
   04925 Aldosterone synthesis and secretion
    109305 (Orai1)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    109305 (Orai1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   109305 (Orai1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 304 aa AA seqDB search
MHPEPAPPPSHSNPELPVSGGSSTSGSRRSRRRSGDGEPSGAPPLPPPPPAVSYPDWIGQ
SYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTDHDYPPG
LLIVFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAF
STVIGTLLFLAEVVLLCWVKFLPLKRQAGQPSPTKPPAESVIVANHSDSSGITPGEAAAI
ASTAIMVPCGLVFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHSLTPG
THYA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggagcctgccccgcccccgagtcacagcaatccggagcttcccgtgagcggc
ggcagcagcactagcggcagccgccggagccgccgccgcagcggggacggggagccctcg
ggggccccaccgctgccgccgccgccacccgccgtcagctacccggactggatcggccag
agttactccgaggtgatgagcctcaacgagcactcgatgcaggcgctgtcctggcgcaag
ctctacttaagccgcgccaagctcaaagcttccagccggacctcggctctgctctccggc
ttcgccatggtagcgatggtggaagtccagctggacacagaccatgactacccaccaggg
ttgctcatcgtctttagtgcctgcaccacagtgctagtggccgtgcacctgtttgccctc
atgatcagcacctgcatcctgcccaacatcgaggctgtgagcaacgtccacaacctcaac
tcggtcaaagagtcaccccacgagcgcatgcatcgccacatcgagctggcctgggccttc
tccacggtcatcgggacgctgcttttcctagcagaggtcgtgctgctctgctgggtcaag
ttcttacctctcaagaggcaagcgggacagccaagccccaccaagcctcccgctgaatca
gtcatcgtcgccaaccacagcgacagcagcggcatcaccccgggtgaggcggcagccatt
gcctccaccgccatcatggttccctgtggcctggtttttatcgtctttgctgttcacttc
taccgctccctggtcagccataagacggaccggcagttccaggagctcaatgagctggcc
gagtttgcccgcttgcaggaccagctggaccacagaggggaccattctctaacaccgggc
acccactatgcctaa

DBGET integrated database retrieval system