KEGG   Mus musculus (mouse): 109333Help
Entry
109333            CDS       T01002                                 

Gene name
Pkn2, 6030436C20Rik, AI507382, PRK2, Prkcl2, Stk7
Definition
(RefSeq) protein kinase N2 (EC:2.7.11.13)
  KO
K06071  
protein kinase N [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    109333 (Pkn2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    109333 (Pkn2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     109333 (Pkn2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKN family
   109333 (Pkn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 H1; 3 66.69 cM
AA seq 983 aa AA seqDB search
MASNPDRGEILLTELQGDSRTLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKNLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDSTDCPR
TPDTPNSDSRSSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFKIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNELPRNHPKSSVVIEELSLVA
SPTLSPRQSMLSTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSP
SDNRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKF
TLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNP
VIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQTPVP
ATVPVVDARIPDLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGETDESSELRVLDIPGQ
GSETVFNIENDRNNLRPKSKSEYELSIPDSGRSCWGVGELDDKRAQQRFQFSLQDFRCCA
VLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLV
NLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYR
DLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWW
GLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLG
AGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPR
EPRILLEEEQEMFHDFDYVADWC
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaccccgaccggggggagatcctcctcaccgagctgcagggagattcccgg
actcttccattttctgagaatgtgagtgctgttcagaaattagacttttcagatacaatg
gtgcaacagaaattggacgacatcaaggatcgaataaagagagaaataaggaaagaactg
aaaatcaaagaaggagctgaaaacctgaggaaagttacaacagataagaaaaatttggct
tatgtagacaacattttgaaaaaatcaaataaaaaattagaagaattacatcacaagcta
caagaattaaatgcacacatcgttgtatcggatccagaggactccacagattgtccgagg
actccagatactccaaatagtgactctcgtagttctactagcaacaatagactgatggcc
ttacagaaacaactggatatagaacttaaagtaaagcagggtgcagagaacatgatacag
atgtactcaaatggctcttcaaaggatcggaaactccatggtacagcgcagcaactgcta
caggatagcaagacaaaaatagaagtcatccggatgcagattcttcaggccgtccagacc
aatgagctggcttttgataatgcaaaacctgtgataagccctcttgagcttcggatggaa
gaattaagacatcattttaagatagaatttgcagtagccgaaggtgcaaagaatgtcatg
aagttacttggctcaggaaaagtaacagacagaaaagcgctttcagaagcacaagcgaga
tttaatgaatcaagtcagaagttggaccttttaaagtattcactagagcaaaggttaaat
gagctccccaggaatcaccccaaaagcagtgtcgtcattgaggagctttcactggttgcg
tcaccaaccctgagtccacggcagagcatgctgtccacgcagaaccagtatagcacactg
tccaagccagcggcgctaaccggtactttggaagttcgtcttatggggtgccaagatatc
ctagagaatgtacctggacggtcaaaagcaacgtcggtagcactacctgggtggagtcca
agtgacaacagatcgtcttttatgagcagaaccagcaagagtaaaagtgggagtagtcgc
aacctcctgaaaacggatgacttgtccaatgatgtttgtgctgttttgaagctagataat
actgtggttggtcaaactagctggaaacccatttcaaatcagtcgtgggaccagaagttt
acactggaactagacaggtcacgtgaactggaaatttcagtttattggcgtgattggcga
tctctgtgtgctgtaaaatttctgaggttagaagattttttagacaaccagcggcatggc
atgtgtctctatttggaaccacagggtactttgtttgcagaggttactttttttaatcca
gttattgaaagacgaccaaaactccaaagacaaaagaaaattttttcaaaacaacaaggc
aaaacatttctcagagctcctcagatgaatattaatattgccacttggggaagactagtg
agacgagctattcccacagtaaatcattctggcacattcagccctcagactcctgtgcct
gcaacagtgccagtcgttgacgcacgcattcctgatctagcacctccggccagtgactct
acagtaaccaaattggactttgatcttgaacctgaacctcctccagccccacctcgtgct
tcttcccttggagagacagatgaatcttctgaattgagagttttggatatacctggacag
ggttcagaaactgttttcaatattgagaatgacagaaataacctgcgtccaaaatccaaa
tctgaatatgagctgagcattcctgactcaggtcgaagctgctggggtgttggagagctt
gatgacaagagagctcagcagaggtttcagttcagtctacaggacttcaggtgctgtgct
gtcttggggagaggacactttggaaaggtgctgttggcggaatataaacacacaaatgaa
atgtttgcaataaaagccttaaagaaaggagacattgtggcacgagatgaagtagacagc
ctgatgtgtgaaaaaagaatttttgagactgtgaatagtgtcaggcacccgtttctagtg
aacctttttgcatgtttccaaacaaaagaacatgtttgcttcgtgatggagtatgctgca
ggtggtgacctgatgatgcacatccatactgatgtcttctctgaacccagagctgtattt
tatgcagcatgtgtagttcttgggttgcaatacttacatgaacacaaaattgtttataga
gatttgaagttggataacttgttgctagatacagaaggctttgtgaaaattgctgacttt
ggtctttgcaaagaaggaatggggtatggagataggacaagcacattttgtggtactcct
gagtttcttgccccagaagtcctaacagaaacatcgtacacaagggctgtagattggtgg
ggccttggtgtacttatatatgagatgctcgtcggcgagtctccctttcctggtgatgat
gaagaagaggtttttgacagtattgtaaatgacgaagtaaggtatccaaggttcttatct
acagaagccatttccataatgagaaggctgctaaggagaaatcctgagcggcgcctggga
gctggtgagaaggatgcagaggatgtcaagaagcacccgtttttccggctaaccgactgg
agtgctctaatggacaaaaaagtaaagccaccatttgtacctaccattagaggacgggaa
gatgttagtaactttgatgatgaatttacctcagaagcacctattctgactccacctcga
gaaccaaggatactcttggaagaggagcaggagatgttccacgattttgactacgttgct
gattggtgttaa

DBGET integrated database retrieval system