KEGG   Mus musculus (mouse): 109697Help
Entry
109697            CDS       T01002                                 

Gene name
Cpa1, 0910001L12Rik, Cpa
Definition
carboxypeptidase A1, pancreatic (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    109697 (Cpa1)
   04974 Protein digestion and absorption
    109697 (Cpa1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     109697 (Cpa1)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   109697 (Cpa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 B1; 6 12.52 cM
AA seq 419 aa AA seqDB search
MKRLLVLSVLLAAVFGNENFVGHQVLRISATDEAQVQKVRELEELEHLKLDFWRDPARAG
LPIDVRVPFPTIQSVKAFLEYHDISYEIMIEDVQSLLDEEKQQMSAFQARALSTDAFNYA
TYHTLDEIYEFMDLLVTEHPQLVSKIQIGSTFEGRPINVLKFSTGGTNRPAIWIDTGIHS
REWVTQASGVWFAKKITKDYGQEPTLTAILDNMDIFLEIVTNPDGFVYTHKTNRMWRKTR
SHTEGSLCVGVDPNRNWDAAFGMPGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIK
AFISIHSYSQLLLYPYGYTSEPAPDKEELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQA
SGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctgctggttctgagtgtgctgctggcagcagtcttcggcaatgagaacttt
gtggggcaccaggttctccgaatctctgccaccgacgaagcccaggtgcagaaagtgagg
gagctggaggagttggagcacttgaagttggacttctggcgggaccctgcccgggctggt
ctccccatcgatgttcgagtgcccttccccaccatccagtccgtgaaagcattcttggaa
tatcatgatattagctatgagatcatgatcgaagatgtgcagtctctgctcgacgaggag
aagcagcagatgtccgccttccaggccagggctctgtccaccgatgctttcaattatgcc
acctaccatactctggatgagatctatgaattcatggacctgctggttacagagcaccca
cagcttgtaagcaagatccagatcggcagcacctttgaaggtcgtcccatcaatgtgctg
aagttcagcactggagggaccaatcgcccagcaatctggattgacactggcatccattcc
agggagtgggtcactcaggccagtggggtctggtttgcaaaaaagatcacgaaggactat
ggccaggaacccaccctcacggccattcttgacaacatggacatcttcctggagattgta
actaaccctgatggttttgtctacacccacaaaacgaatcgcatgtggcgcaaaactcga
tcacacaccgagggctccctctgcgtcggggtggaccccaacaggaactgggatgctgcc
tttgggatgcccggagctagtagcaacccctgctcagaaacttaccgtggcaagtttccc
aactctgaagtggaggtcaagtccatcgtggactttgtgacgagccacgggaacatcaag
gccttcatctccatccacagctactcccagctccttctctacccctatggctacacatca
gaaccagctcctgacaaggaggagctggatcagctagcaaaatctgctgtgacagccttg
acatctctacacgggaccaagttcaagtatggcagtatcattgatacgatctatcaagcc
agtgggagcactattgactggacctacagccagggcatcaagtattccttcacttttgag
ctgagggacactgggctcagaggtttcctgctgcctgcctcccagatcatccccacagcg
gaggagacatggctggcccttttgaccatcatggaccacactgtcaaacacccctactga

DBGET integrated database retrieval system